KEGG   Martelella sp. AD-3: AZF01_18220
Entry
AZF01_18220       CDS       T04332                                 

Definition
(GenBank) 3-phenylpropionate dioxygenase
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
maad  Martelella sp. AD-3
Pathway
maad00621  Dioxin degradation
maad01100  Metabolic pathways
maad01120  Microbial metabolism in diverse environments
maad01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    AZF01_18220
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AMM86964
UniProt: A0A127CQ95
Position
complement(3962767..3963039)
AA seq 90 aa
MSEGEMKVFEGGPEPILVCRVDGEIHAVQDTCTHDTWSLADGFIEDGVIECSLHFAKFCV
RTGKVKALPACEALKVFPAKVDGDFIYINC
NT seq 273 nt   +upstreamnt  +downstreamnt
gtgtcggagggagagatgaaggtattcgaaggtggccctgagccgatactggtgtgccga
gtggacggcgaaatacacgccgtccaagacacctgtacgcatgacacatggtcactcgcg
gacggttttatcgaggacggagttatcgagtgcagtctgcacttcgcgaaattttgcgtc
agaaccggcaaggtgaaggccctgcctgcttgtgaggcactcaaggtgtttcctgcaaag
gtcgacggcgacttcatatacattaactgctga

DBGET integrated database retrieval system