KEGG   Martelella sp. AD-3: AZF01_18315
Entry
AZF01_18315       CDS       T04332                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
maad  Martelella sp. AD-3
Pathway
maad00626  Naphthalene degradation
maad01100  Metabolic pathways
maad01120  Microbial metabolism in diverse environments
maad01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AZF01_18315
Enzymes [BR:maad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     AZF01_18315
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AMM86059
UniProt: A0A127CMH4
Position
3981250..3982245
AA seq 331 aa
MKHELLTVDDVTGCWAIMPTPSKPNASDPSAEDTVDLDETARVVEALIASGVNGILSLGT
LGEGATTTWDEKRGFMQTLVEVGRGRVPIFGGATALNTRDSISMTKAAREIGLDGVMLGL
PMWVQPDVPTAVQFFRDVAEACPDMAICAYANPEAFKFEFPRAFWAQISEIPQIVSAKYI
NTAALYTDLNLTKRRIRLMPLDVDYYAAARLDPEHCTAFWTSGAVCGPTPVIQLRDLVAE
AVKSGDWTRAKALTDRIGLTYRTLFPNGSFKEFSVYNIGIEKARMDAAGWMVAGPCRPPY
HLVPETVLEGARESGRQWAKLVAELEAEGGK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaacatgaacttctcacggtcgatgacgtgacgggttgctgggcaatcatgcccacg
ccgtccaagcccaacgcttcggacccgagcgcagaggacacggtcgatctggacgaaact
gctcgcgtcgtggaggctctaatcgcctcgggcgtgaacgggattctctctctcggtacc
ttgggggagggcgccactacaacctgggacgagaagcgcggtttcatgcagacgctcgtc
gaggtggggcgcggccgcgttcccatcttcggcggcgcgaccgccctcaatacccgcgac
tccatcagcatgaccaaggccgcgcgcgagatcgggcttgacggggtgatgctggggctt
ccaatgtgggtgcagcctgatgtgcctactgctgttcagttctttcgtgatgtggccgaa
gcctgcccggacatggcgatctgtgcttacgccaaccccgaggcattcaagttcgagttc
ccgcgtgccttctgggcgcagatctctgaaattccgcagattgtgtccgcaaagtacata
aacaccgctgcgctttataccgacctgaacctgaccaagcgccgtattcgactgatgccg
cttgatgtggactattatgccgccgcccggctcgaccctgaacactgcacagcgttctgg
accagtggtgcggtttgcgggcctactccggtgatccagcttcgggatcttgtggcggag
gcggtgaagagcggcgattggacccgtgccaaagcactgaccgacagaattggcctcaca
tatcggacactcttccccaacggttcgttcaaggagttctcagtttacaacatcggtatt
gagaaagcccgtatggacgcggcaggctggatggtcgcggggccttgtcgtccgccctat
catctggttcccgagacggttctggaaggcgcgcgggaatccggtcggcaatgggcaaaa
ctagttgccgagcttgaggcagagggcggaaagtga

DBGET integrated database retrieval system