KEGG   Martelella sp. AD-3: AZF01_18805Help
Entry
AZF01_18805       CDS       T04332                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
maad  Martelella sp. AD-3
Pathway
maad00460  Cyanoamino acid metabolism
maad00500  Starch and sucrose metabolism
maad01100  Metabolic pathways
maad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZF01_18805
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AZF01_18805
Enzymes [BR:maad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AZF01_18805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like PA14
Motif
Other DBs
NCBI-ProteinID: AMM86135
UniProt: A0A127CMS2
Position
complement(4078160..4080655)
Genome map
AA seq 831 aa AA seqDB search
MNNDQTGGAAVNIDHLLEELTLEEQVSLMAGADFWTTVPVPRLGIPAVKVSDGPNGARGA
GGLTNGTPAAAFPCAIALGASWNSDAAYEMGAALAAEARSKGARVLLAPTVNMHRSGLNG
RNFECYSEDPLLTSMLAVAYVKGLQDNGVGATIKHFVANDSEIDRQTVSSDVDERTLREI
YLPPFEAAVKKAGVWAVMTGYNRLNGIHMDGHKWALQEVMRGEFGYDGIFMSDWFGTNSV
AASVNAGHDLEMPGPTRHRGARLLDAVKAGEVDPETIRAATRRLLVLFARVGAFDSAGPE
AETSRDAPETRALIRRLGAEGAVLLKNEGNLLPLEKNVSIAALGPNAGVARLMGGGSAQI
NAPYRVTPVAGLKASFGDNRVSHAKGCTNNRLTQVLQGDVELRFHHGRRLEGKPVHIATE
EALNCFWFDLPVPELDQNDFSVQVVATFTPEENGTYRAGMTNAGLARAYLDGELLIDGES
DWSHGQNFFGAANDERQVEIELQAGTTYQLVIDYCSPDSAENGITVRALRFGIEKTMGEQ
DIDDAVRLAAEQDVAVLFVGRQEEWDSEGHDLPDMTLPGRQNALIEAVAAVNPNTVVVLQ
TGGPVEMPWLEKVKSVVQFWYPGQEVGNAIADVLSGAAYPGGRLPQTFPRRMKDNSAWSD
DALTYPGKDGHVRYGEGVFVGYRHHDSRDVPPLFPFGFGLGYTRFDWGDATADTAIMTDA
GVIVTVPIVNSGAADGVEVVQLYVQPEAMVDDVPVARPKKELRAFARLALTPGEHGTASL
GIVPRDLAYFDVERQRWVAPAGRYTLLVAANAGDIRQRLTVDLETEWSEPA
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgatcagacgggcggcgcggccgtcaatattgaccaccttctggaggagctg
accctggaggaacaggtgtcgctgatggcgggcgcggatttctggaccaccgttccggtg
ccgcgcctcggcatcccggccgtgaaggtttccgatggccccaatggcgcgcgcggcgcg
ggcggcctgaccaacggcacgccggcggccgccttcccctgcgccatcgcgcttggcgcg
agctggaacagcgatgcggcctatgaaatgggggcggcgctggccgccgaggcgcgttcg
aaaggcgcgcgggtgctgctggcgccgacggtcaacatgcaccgctcgggtctgaacggt
cgcaatttcgagtgctattcggaagacccgctgctgacgtccatgttggccgttgcctat
gtcaagggcctgcaggacaatggcgttggcgcgacgatcaagcatttcgtcgccaatgat
tccgaaatcgaccggcagacggtttcatccgatgtcgatgaacggacgctgcgggagatc
tacctgccgccgttcgaggcagcggtcaagaaggcaggcgtctgggcggtgatgaccgga
tataaccggctcaacggcatccatatggacggccacaaatgggcgctgcaggaggtgatg
cgcggtgagttcggttatgacggcatcttcatgtcggactggttcggcacgaattcggtc
gcggcctcggtcaatgccggacacgatctcgaaatgcccgggccgacgcgccaccgcggc
gccaggcttcttgacgccgtaaaggccggggaggtcgatcccgagacgatccgtgccgca
acgcgccgcctgctcgtcctgttcgcgcgcgtcggcgcgttcgacagcgccggtcccgag
gcggaaacctcgcgtgatgcgccggagacccgtgcgctgatccgtcgtctcggcgcggag
ggcgcggttcttttgaagaatgaaggcaatctgctgccgctcgaaaagaacgtatcgatt
gccgcgcttggccccaatgccggcgtggcgcggttgatggggggcggttcggcgcagatc
aacgcgccctatcgggtgacgccggtcgcggggctgaaggcctccttcggcgacaatcgc
gtttcccatgccaagggctgcaccaacaacaggctgacgcaggtcctgcagggcgatgtc
gagcttcggttccatcacggccgccggcttgaaggcaagcccgttcatatcgcaaccgag
gaggcgctcaactgcttctggttcgatcttccggtcccggaactggaccagaacgatttt
tccgtgcaggtcgtcgcgactttcaccccggaggaaaacgggacctaccgcgccggcatg
accaatgccggtctcgcgcgcgcctatcttgacggcgaactgctgatcgacggcgagagc
gactggtcgcacggacagaactttttcggtgcggccaatgacgagcgacaggtcgaaatc
gagcttcaagccggaaccacctatcagttggtcatcgactattgttccccggattcggcc
gagaacggcatcaccgttcgcgcgctccggttcgggattgaaaagaccatgggcgagcag
gacatcgatgatgccgtcaggcttgcggcggagcaggatgtggcggtgctgttcgtcggc
cgccaggaggaatgggacagcgaggggcacgatctgccggacatgacattgcccggccgg
cagaatgcgctgatcgaggctgtggccgccgtcaatccgaacacggttgtggtgctgcag
accggcggtccggtggagatgccctggctcgagaaggtgaaatcagtcgttcagttctgg
tatccgggacaggaggtcggcaatgcgattgccgatgtgctgagcggcgcggcctatccc
ggcggccggctgccgcagaccttcccacgccgcatgaaggacaattcggcctggagcgac
gatgcgctcacctatcccggcaaggacgggcatgtgcgctacggtgaaggcgtattcgtc
ggctatcgccatcacgacagccgcgatgtgccgccgctcttccccttcggtttcggcctc
ggatacacccggtttgactggggcgacgccacggcggacaccgcgatcatgacggatgcc
ggggtcatcgtcaccgtaccaatcgtcaattcgggggcggcggatggcgtcgaggtcgtg
caactctacgtgcagccggaggcgatggtggacgacgtgcccgtcgcccgcccgaaaaag
gaactacgcgccttcgcccgcctcgccctcacgccgggcgagcacggaacggccagcctc
ggcatcgtgccgcgcgatcttgcctatttcgatgtcgaacgccagcgatgggtggcgccg
gcgggtcgctatacgcttcttgtcgccgccaatgccggcgatatccgccagcgtctcacc
gtcgatctcgagaccgagtggtcagaaccggcctga

DBGET integrated database retrieval system