KEGG   Martelella sp. AD-3: AZF01_19490Help
Entry
AZF01_19490       CDS       T04332                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
maad  Martelella sp. AD-3
Pathway
maad00040  Pentose and glucuronate interconversions
maad00053  Ascorbate and aldarate metabolism
maad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZF01_19490
   00053 Ascorbate and aldarate metabolism
    AZF01_19490
Enzymes [BR:maad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AZF01_19490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMM86248
UniProt: A0A127CN24
Position
complement(4223369..4224898)
Genome map
AA seq 509 aa AA seqDB search
MKITGELLIGNQTRMGENGTLTAVEAATGKALSGAFGGASAADLDQAARLAWQAFTIYRE
TALEERAAFLEKAAENILEIGDLLIERAMAESGLPRARLEGERMRTVNQLRLFAGVVREG
AFQDLRFDPADAARTPPKPDLRLRKLGLGPVAVFGASNFPLAFSVAGGDTASALAAGCPV
VVKAHPAHPGTSELVARALQQAVIDSGMPEGTVSMLHDTGYEVGAALVVHPLIRAVGFTG
SRRGGLALVDIAAKRKMPIPVYAEMSAINPVLLFPEALKARGGKIGAGFAASLTLGAGQF
CTNPGLILAVEGEGLEAFKASAVEALKAIPAQTMLTSGICKAYREGVAKLVGHSDVTQLA
EGQEGDEFHGQAALFETTAASFLADKSLHDEVFGGAGLIVRCRDLAELEIVVDGIEGQLT
VALHIAEADYPAAKKLMPKLEMLAGRLLVNGFGTGVEVSPAMVHGGPYPATSDARSTSVG
TLAIDRFLRPVSYQDMPADLLPAALRNRD
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaccggtgaattgctgatcggcaaccagacccgcatgggcgaaaacggcacg
ctgacggctgtggaagcggccaccggaaaggcgctttccggcgcgttcggcggcgccagc
gccgccgacctcgaccaagcggcacggctcgcgtggcaggccttcaccatctatcgtgaa
acggcgctggaggagcgggccgcatttctggaaaaggcggccgagaacatcctggagatc
ggcgatcttctgatcgagcgcgccatggccgaaagcggcctgcctcgtgcgcggcttgaa
ggcgagcgcatgcgcacagtcaaccagttgcgtctcttcgccggcgttgtgcgcgaaggc
gcgtttcaggatctgcgtttcgaccccgccgatgcggcgcgcacgccgcccaagcccgat
ctcagactgcgcaagctcggcctcggcccggttgccgtcttcggggcatcgaattttccg
ctcgccttttcggtcgccggcggcgacaccgcctcggcgctcgccgccggctgcccggtc
gtggtcaaggcccatccggcccatcccggcacctcggaactggtcgcccgcgccttgcag
caggcggtgatcgatagcggcatgccggagggcacggtctcgatgctgcacgataccggc
tatgaggtcggagccgcgctggtcgtccatccgctgatccgcgccgtcggcttcaccggc
tcgcgccggggcggactggcgctggtcgacatcgccgcaaaacgtaaaatgccgatcccg
gtttatgcagagatgagcgccatcaacccggtcctgctgtttcccgaagcgctgaaggcg
cgcggcggcaagatcggtgcgggttttgccgcatcgctgacgctcggcgccggccagttc
tgcaccaatcccgggctgatcctcgccgtcgaaggcgagggacttgaggccttcaaggca
agcgccgtcgaggcgctgaaggcaataccggcgcagacgatgctgacttccggcatctgc
aaggcctaccgcgaaggtgtggcaaaactggttggccacagcgatgtgacgcagttggct
gaagggcaggaaggcgacgagtttcacggccaggcagccctttttgaaacgaccgccgcg
tccttccttgccgacaagagcctgcatgacgaagtcttcggcggggcgggtctgatcgtc
agatgccgcgatctggcggaactcgaaatcgtggtcgacggcatcgaaggccagttgacg
gtggcgctgcacatcgccgaagccgactatccggcggcgaagaagctgatgccgaagctg
gaaatgctggccggtcgcctgctcgtcaacgggtttggcaccggcgtcgaggtctctccg
gccatggtccatggcgggccgtacccggcgacctcggacgcgcgctcgacctcggtcggc
acgctcgcgatcgaccgcttcctgcgcccggtttcctatcaggatatgccggcggacctg
cttccggcggccctgcgcaaccgagactga

DBGET integrated database retrieval system