KEGG   Martelella sp. AD-3: AZF01_22050Help
Entry
AZF01_22050       CDS       T04332                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maad  Martelella sp. AD-3
Pathway
maad00071  Fatty acid degradation
maad00072  Synthesis and degradation of ketone bodies
maad00280  Valine, leucine and isoleucine degradation
maad00310  Lysine degradation
maad00362  Benzoate degradation
maad00380  Tryptophan metabolism
maad00620  Pyruvate metabolism
maad00630  Glyoxylate and dicarboxylate metabolism
maad00640  Propanoate metabolism
maad00650  Butanoate metabolism
maad00900  Terpenoid backbone biosynthesis
maad01100  Metabolic pathways
maad01110  Biosynthesis of secondary metabolites
maad01120  Microbial metabolism in diverse environments
maad01130  Biosynthesis of antibiotics
maad01200  Carbon metabolism
maad01212  Fatty acid metabolism
maad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZF01_22050
   00630 Glyoxylate and dicarboxylate metabolism
    AZF01_22050
   00640 Propanoate metabolism
    AZF01_22050
   00650 Butanoate metabolism
    AZF01_22050
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZF01_22050
   00072 Synthesis and degradation of ketone bodies
    AZF01_22050
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZF01_22050
   00310 Lysine degradation
    AZF01_22050
   00380 Tryptophan metabolism
    AZF01_22050
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZF01_22050
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZF01_22050
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZF01_22050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maad04147]
    AZF01_22050
Enzymes [BR:maad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZF01_22050
Exosome [BR:maad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZF01_22050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMM87208
UniProt: A0A127CQW9
Position
unnamed1:complement(217237..218439)
Genome map
AA seq 400 aa AA seqDB search
MREAAIVSTARTPIGKAYRGAFNATTAPRLIGHAIEHAVSRAGVDPAEIEDVVVGAALQQ
GTTHMNIARTGLLRAGLPVTVPGQSVDRQCASGLMAIAIAAKEIISDGMAVTIGGGVEQI
SLVQTPEMNTRHWQDPWISDRLPATYMAMVETAEIVARRYGVSREAQDAYALQSQQRTAA
AQAAGRFDDEIVPLSTVMQVTDRETGETTMREVTLERDEGNRPSTTLDGLAGLAPVFKDG
QQVSQGAFVTAGNASQLSDGASAAVLMERREAERRGLAPLGLYRGIAVTGVSPEEMGIGP
ISAVTKLLATHDLSVDDIGLWELNEAFAAQVIPSRDQLGIPDELLNVNGGAISIGHPYGM
SGARMVGHALIEGRRRGARHVVVTMCIGGGMGAAGLFEVL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagccgccatcgtttcgaccgcccgcacgccgatcggaaaagcctatcggggc
gcgttcaacgccaccacggcaccccggctgatcggccatgccatcgagcatgccgtcagc
cgcgccggtgttgatcctgcggagatcgaggatgtggtcgtcggcgccgccctgcagcag
ggcaccacccatatgaacatcgcgcgcacgggccttttgcgcgccggccttccggtaacc
gttccgggccagagcgtcgaccggcaatgcgcgtccggcctgatggcgatcgcgatcgcg
gccaaagagatcatatcggacgggatggctgtgacgatcggcggcggagtcgagcagatt
tcgctggtgcagacgcccgaaatgaacacccgtcactggcaggacccctggatcagcgac
cggctgccggcgacctatatggcgatggtggaaaccgccgaaatcgtcgcgcgccgctat
ggcgtgagccgcgaagcccaggatgcctatgcgctgcagtcgcaacagcgcaccgccgcc
gcccaggcagccggtaggttcgatgacgagatcgtgccgctcagcaccgtcatgcaggtc
accgaccgcgagaccggcgaaaccacgatgcgcgaggtgacgcttgagcgcgacgagggc
aaccgaccttccacgaccctggacggtctcgcaggccttgccccggtcttcaaggatggc
cagcaggtgtcgcagggcgcgttcgtgacggccggcaacgcctctcaattgtccgatggc
gcttccgccgcggtgctgatggagcggcgcgaggcggaacgccgtgggctcgctccgctc
ggcctttatcgcggcatcgccgtgaccggggtttcgcccgaagagatggggatcggcccg
atatccgcggtcacgaagcttcttgccacccacgatctgagcgttgacgacatcggtctt
tgggagctcaacgaggccttcgccgcacaggtcatcccctcgcgcgaccagcttggcatt
cccgatgagctgctgaacgtgaacggcggcgcgatatcgatcggccatccctacggcatg
tcgggcgcgcgcatggtcggccacgccctgatcgagggcaggcggcgcggcgcgcgccat
gttgtcgtcaccatgtgcattggcggcggcatgggcgcggcgggactattcgaagtcctg
tag

DBGET integrated database retrieval system