KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0104Help
Entry
MAB_0104          CDS       T00657                                 

Definition
(RefSeq) Probable enoyl-CoA hydratase/isomerase
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 5962647
NCBI-ProteinID: YP_001700858
Structure
PDB: 

Position
105363..106145
Genome map
AA seq 260 aa AA seqDB search
MTELHEEIRDGVAVLTLHGPSTRNSFTVELGRQLGAAYQRLDDDPAVRVIVLTGAPPAFC
SGAQISAAAETFAAPRNPDFSASPVQPAAFELRTPVIAAVNGHAIGIGMTLALHADIRIL
AEEGRYAIPQVRFGVAPDALAHWTLPRLVGTAVAAELLLTGASFSAQRAVETGLANRCLP
AGKVLGAALRMAHDIATNVAPESAALTKRLLWDAQMTGMSAAEVAARETADHLRLMGSQD
AAEGPRAFIDGRPPRWAGQR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaactccacgaagaaattcgtgacggggtagcggttctcacgctgcacggaccg
tcgacgcggaactccttcacggtcgagctgggtcgtcaactcggcgccgcatatcagcgg
ctcgacgacgatccagctgttcgtgtcatcgtgctcaccggcgcgccacccgcgttctgc
agtggtgcccagatctcggcggccgcggaaacatttgcggcgccgcgtaatccggacttc
tcggcgtcgccggtgcaaccggccgcgttcgagctgagaacccccgtcatcgcggcggtg
aacggacacgcgatcggtataggaatgacgctggcgttgcatgcggacatccgcatcctt
gccgaggaggggcgttatgccataccgcaggtgcggttcggagtggcacccgatgcgctg
gcgcactggacgctgcccaggctggtcggtactgcggtagcggcggagctactgctcacc
ggcgcgagtttctcggcacagcgggccgtcgagacaggcttggccaaccggtgtctgccc
gcaggaaaggtactgggtgcggccctgaggatggctcacgatatcgcgacaaacgtggcg
cccgagtccgcggccctgaccaagcggctgctctgggatgcgcagatgacggggatgtca
gcggccgaggtggcggcacgggagacggcagaccacctgcgtttgatgggctcgcaggat
gcggccgagggcccgcgcgcgttcatcgacggccgcccgccgcgctgggccggtcagcgg
tag

DBGET integrated database retrieval system