KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0105cHelp
Entry
MAB_0105c         CDS       T00657                                 

Definition
(RefSeq) Probable oxidoreductase
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALO FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 5962648
NCBI-ProteinID: YP_001700859
UniProt: A0A0U1BZJ8
Position
complement(106396..107634)
Genome map
AA seq 412 aa AA seqDB search
MLVRPRSEDELAFALRRSAGRTVRPIGSSHSFTQLCVTEDVQIDVSEMRRLISIDAQDRV
RVQAGISLHELNRTLLRHGLALPNLGDIDVQTLAGAAATGTHGTGLKFGNISQTILSMRI
MTADGTIHELDDGDALRAARISLGALGVVTEFTLQCVPAFRLHRSQSVHDLDTVLADLPT
LLADTDHLELYLFPHTRRVLLLQSTRTDEAPWPRNPVKHWVERDLVENGALGALMWTAGR
LPAAAPRISKLVAALASSNESQDESAAVFASPRKVKFTEMEYSLPLTNAREAIETALATI
ERDRHQVAFPLEVRFTQADDALLAPAYGRESVYLAVHQTVHGSWESYFGGLEPILIGLGG
RPHWGKRHTLTAQQLSERYPEWGTFQDIRARLDPGGTFSGGYLNRLLGPVSP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgcgtccccggtctgaagatgaactggcgttcgcgctgagacgttcggccggg
cgcaccgtgcgaccgatcggctcctcgcattcctttacccaactgtgcgtcaccgaggat
gtgcagattgatgtctccgaaatgcggcgactgatatcgatagacgctcaggaccgggtg
cgggtgcaagccggaatcagcctccacgaactgaaccgcacgttgttgcggcacgggctg
gcgctgcccaacctcggcgacatcgacgtccagacactggccggggcggccgcgaccggc
acccatgggaccggcctgaagttcggcaacatctcccagaccatcctctcgatgcgcatc
atgaccgccgacggcactattcatgagctcgacgacggcgatgcgctgcgcgccgcgcgg
atatcactgggtgcactcggcgtggtcaccgagttcaccttgcaatgcgtcccggccttc
cggctgcaccgcagccagtccgttcacgaccttgataccgtactggccgacctccccacg
ttgctggcggacaccgatcatcttgagctgtatctgtttccacacacgcgtcgggtactg
ctgctgcaatccacccggaccgacgaggcgccatggccacgcaatccggtcaaacactgg
gtggaacgcgacctggtggaaaacggggcactcggcgcgttgatgtggacggccggccgc
ctacccgctgccgcccctcggatatccaaacttgttgcagcgctggctagttccaatgag
tcgcaggatgaaagcgcggcggtgttcgcgagcccacgcaaggtgaagttcaccgagatg
gagtattcgctcccgctgaccaacgcccgtgaggcgatcgagaccgcactggccaccatc
gaacgagatcgccatcaggtggctttccccctggaggtccgttttacccaggccgacgac
gcgctgctcgcaccggcttatggccgcgaaagtgtgtatctcgctgtgcaccaaacggtg
cacggttcatgggagtcctacttcggcggcctcgagcccatcctgatcggcttgggcggt
cggccgcattggggcaagcggcacacgttgacggcccaacagttaagtgagcgctacccc
gaatggggcacgttccaggacatccgtgcacggcttgaccctgggggtacgttcagcggc
ggatatctgaaccggctgctcgggccggtcagcccctga

DBGET integrated database retrieval system