KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0106cHelp
Entry
MAB_0106c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N
Motif
Other DBs
NCBI-GeneID: 5962649
NCBI-ProteinID: YP_001700860
UniProt: A0A2C9Y9T0
Position
complement(107679..108866)
Genome map
AA seq 395 aa AA seqDB search
MSVRRLAEALRGAPAPLAAVDIDAARSNAATLVDAASGLPIRVASKSIRSTALIRKFLEI
PGFHGVLAFTPAEAVHLGDAGVDDVLIAYPSVDRGALATAARHRSVIRPLIDSADHVRLL
AEISRETNAPIPVCLDIDAGWRPLGGPVHLGPKRSPVRTPEQAAALTDLVCATPGLRLAA
VMAYDGQIAGVGDIVPGNPWYQLAVRGMQASSLRELGERLPRVLDAVTARLRAAGAPPLE
LVNSGGTGSLARIAGLGFATELAAGSGFFAPALFDHYRSLHLEPAAAFALPVVRKPAPGL
ATVLGGGYIASGPAGASRVPVPSWPPGLSFEASEGAGEVQTPLRGARALRIGDAVWFRHA
KAGELCEHFTELQLVEGGQHAGSVSTYRGEGMMFL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcggcggctggcggaggcactgcggggagcaccggcgccgctggccgcggtc
gacatagacgcggcgcggagcaacgccgcgacgctggtcgacgccgcatccgggctgccc
attagggtagccagcaagtccatacgcagcaccgcactgattcgaaaatttctggaaata
ccgggttttcacggagttcttgcgtttactccggcggaggccgtgcatttgggcgatgcc
ggcgtcgacgacgtgttgatcgcctaccccagcgtcgatcgcggggctctggcgacggca
gcccggcatcgctctgtcatccggcctctgatcgactcggccgaccacgtgcgcctgttg
gccgagatatcgcgtgagacgaacgcacccatcccggtgtgtctggacatcgatgccggt
tggcgaccgctgggtggtccagtacatctgggacccaagcgatcgccggtacgcactcct
gagcaggcggcagcactgaccgatctggtgtgtgcgacgccggggctacggcttgcagct
gtgatggcttacgacgggcagatagccggggtcggcgatattgtgccgggaaatccgtgg
taccagttggcggttcgggggatgcaggcctcatccctgcgcgagcttggtgagcgcctc
ccccgggttctggatgcggtgaccgcacgactgcgcgcggcgggggcaccgccgctggag
ttggtgaactccggtggcaccggcagccttgcccgcatcgcagggctcggcttcgccacc
gaactggccgccgggtccggcttcttcgcacccgccctgttcgatcattaccgcagcctg
cacctggagccggccgccgccttcgcgctgccggtggtacgtaaacctgcaccagggctc
gcgaccgtgctcggcggcggatacatcgccagtggcccggccggtgccagccgggtgccg
gtgccgtcgtggccgcccggtttgtccttcgaggcttcggaaggggccggggaggtacaa
acgccgttacggggagcacgcgcgctgcggatcggcgatgcggtgtggttccggcacgcc
aaggccggtgaactctgcgagcatttcaccgagttacagctcgtcgaagggggacagcac
gccggatcggtgtcgacgtatcgcggcgagggaatgatgtttctgtga

DBGET integrated database retrieval system