KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0107cHelp
Entry
MAB_0107c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
  KO
K02553  regulator of ribonuclease activity A
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
Messenger RNA biogenesis [BR:mab03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     MAB_0107c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like
Motif
Other DBs
NCBI-GeneID: 5962650
NCBI-ProteinID: YP_001700861
UniProt: A0A0U1C0V6
Position
complement(108866..109354)
Genome map
AA seq 162 aa AA seqDB search
MTTAPITPRPTADLGDELGIDMASCDLQLNQYGARPVFAGVITTVRCHHDNALLKSVLSE
PSSGGVLVIDGGGSLHCALVGDVIAGLAVASGWSGLVINGVVRDSAELATMDIGIKALGT
NPRKGHKTGAGERDVVVSFGGIDFTPGAICYADHDGVVVVPA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcaccgatcaccccccgaccgaccgccgacctgggagacgagctcggcatc
gatatggccagctgcgatcttcagctcaatcagtacggcgcgcggccggtgttcgccgga
gtcatcaccacggtgcgctgccaccatgacaatgcactattgaaatccgttctgtccgaa
ccgagttcgggcggcgtactagtcatcgacggtggtggctcgctgcactgtgccctagtg
ggcgacgtgatcgctggcctcgccgtcgccagtggctggtccggccttgtcatcaacggc
gtcgtccgggacagtgccgaactggcgaccatggacatcggcatcaaggctctcggcacc
aacccccgtaagggccacaagaccggggcgggggagcgtgatgtcgtcgtcagcttcggc
ggtatcgacttcacgccgggcgcgatctgctatgccgaccatgacggcgttgtcgtggtt
cctgcctga

DBGET integrated database retrieval system