KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0110cHelp
Entry
MAB_0110c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1775
Motif
Other DBs
NCBI-GeneID: 5962653
NCBI-ProteinID: YP_001700864
UniProt: A0A2C9Y8G0
Position
complement(110743..111411)
Genome map
AA seq 222 aa AA seqDB search
MRRVLPRLVAVSTTAAAALVALAIPASAHVRVTTDNTARGGYATLEFSVPNESQTKSLTT
ELTVRLPDVGSASTELLPGWTSAVDRDTAKGTVKSVTWKAVAGNGIGPDQFALFRVRVKL
PDTDSVTFPATQTYADGQVVTWDQQAQPGGAEPEHPAPALDLTQGKADHDGHSAHAPQVS
VTHESGAHEAHPDKTARWFGGIGLILGAVALVLAVTNKRRQQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgtactcccccggctggtcgcggtgtcgaccacggcagcagcggcccttgtg
gcgctcgcgattccggcctccgcgcatgtgcgggtcaccaccgacaacaccgcacgcggc
ggctacgcgacgctggagttctcggttcccaacgagtcccagaccaagtcactgaccacc
gagctgaccgttcggttgccggatgtcggctcggccagcaccgaactgctaccgggctgg
accagcgcggtagatcgcgacaccgccaagggcacagtcaagtcggtcacctggaaagcc
gtggccggcaacgggatcggacctgatcagttcgctttgttccgcgtgcgcgtcaagctc
cctgataccgattcggtgaccttccccgcgacccagacatacgccgacggtcaggtggtc
acgtgggatcaacaggcgcagcccggcggagccgagccggagcatccggcgcccgccctg
gacctgacccagggcaaggccgaccacgacggccactcggcacacgcacctcaggtatcg
gttacccatgaatccggggcacacgaagcgcacccggacaagacggcgcgctggttcggc
ggcatcgggctgattctcggtgctgtcgccctcgtgctcgctgtgacgaacaagcggagg
caacagtga

DBGET integrated database retrieval system