KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0112Help
Entry
MAB_0112          CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5962655
NCBI-ProteinID: YP_001700866
UniProt: A0A2C9Y8L5
Position
112307..113848
Genome map
AA seq 513 aa AA seqDB search
MLFAVGRHRANPSRRSQQLKRASARAAVVTVLSSGTLMGGFGVFAITTPAADAKPGGGSG
NDHDHDHGLGGALHKLTGGLLGGGGGGNGGPGSGGARNAPSAPSFGKSLHGGSGSEGAAG
GNGDSAKSDKDKDKGPGASVPKPGSAGSTGKTADSAAGSAGSGTGTPGANSSAPGGSNGS
SGGGIGGVGTTVGTTLPHSGGAAGVHTPTAEGAAATESSAGTGTHTEEHPSLKGALGSVA
GALAPKTETATTPKTETATSPHTSTAPGATAETPTAGTTHPEHESSAEEPKVPGVTVNMG
GRTIIIWKKKPSTSTHTPGAGTGTNPGHESEGDRDHVINLPGFPALGGATNPDAPFGGAA
GTRTPGGNPSIHTGPVAPPTVPTPKAPAVAIATPPAPPVLAPLAPVVPPTPPVVTVKQAE
GGRGGDVVVTAGGTKQPEAVTKPIQQFVAAETIAPRTGYTDYLRLTKTSEIAAVAIPGAA
GIAMMTFVGAALGYRQAKAGHTVRASAAARFLE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcgccgtggggcgacatcgagcaaatccgagcaggagaagccagcagctgaag
cgtgcctctgcgcgcgccgctgtggtgaccgtgctcagctcggggaccctcatgggggga
ttcggggttttcgccatcaccacgccggccgcggacgcaaaacccggcggaggatcgggc
aacgaccatgaccacgatcacggcctgggtggcgctctgcacaaactcaccggaggcctg
ttgggtggcggtggcggcggtaacggcggcccgggcagcggtggcgcccgtaacgcaccc
tcggccccgagcttcggcaagagcctgcacggcggctccgggtcggaaggtgccgcgggg
ggcaacggcgactccgccaagagcgataaagacaaagacaagggccccggggcgagtgtc
ccgaagcccggatcagccggctccaccggcaagacagccgatagcgcggcaggtagcgcg
ggttcgggcaccggcacgccgggcgccaattccagcgctccgggcggctcgaatggctcg
tccggtggaggaatcggcggcgtggggacgaccgtggggacaactctgccgcactcgggc
ggtgccgctggggtgcacaccccgaccgccgagggtgcggctgccacagaaagctccgct
ggcaccggaactcacaccgaagagcatccttcgttgaagggtgcgctcggctcggtggcc
ggtgcgctggcacccaagacggagaccgccaccacacccaaaacggagacggcgacctca
ccgcacacgtcgacggcgccgggcgcgacggccgagacacccaccgcaggcaccacgcac
ccggagcacgagtcgtcggccgaggagcccaaggttcccggtgtcaccgtgaatatgggc
ggacgcaccatcatcatctggaagaagaagccgagcacttcgacgcacacaccgggtgcg
ggcaccggaacgaatccggggcacgaatccgaaggcgaccgcgaccacgtgatcaacctg
ccgggcttccccgcgctgggcggtgccaccaacccggacgccccgttcggtggagccgcg
ggaacgcggaccccgggcgggaacccaagcatccacaccgggccggtcgcgccgccgacg
gtgcccactccgaaggcgcctgctgttgcgatcgcgacaccgcccgcgccgccggtcctc
gcgccgctggcgccggtcgtgccgccgacgccaccggtcgtcaccgtcaagcaggccgag
ggcggacggggcggtgatgtcgtggtcaccgcgggcggcaccaagcagccagaggccgtc
accaagccgatccagcagttcgtcgccgccgagaccatcgcgccgcgcaccggctacacc
gattacctccgtctgaccaagacatccgagatcgccgcggtggcaattccgggtgccgca
ggtatcgcgatgatgaccttcgtgggagccgcgctcggataccggcaagccaaggccggg
cataccgtgcgcgcctctgccgccgcccgcttcctggaatag

DBGET integrated database retrieval system