KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0114Help
Entry
MAB_0114          CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: INSIG Cation_ATPase_C DUF2593
Motif
Other DBs
NCBI-GeneID: 5962657
NCBI-ProteinID: YP_001700868
Position
114403..115518
Genome map
AA seq 371 aa AA seqDB search
MIAWVIAGLLGMATGLRIGWVLVHKQSPVSTGMIVALGSLALVSALNWEPLTILVDSSLG
WPNISVALSQAALTACAAGSCVMITSMSASRTAVANKRWARWQYLAATVIGGASLAVFFS
RGRQPEMTPREFLKRDLGGFASGTAWLVPMLYIAVALSVVLWAGMAYSNRTRRGRALFLF
TVGISLLVLAVLVVAGVAVAQSEYVTIGTAATLIGCAMAMVAVGALLPTFETWLVARREM
FVLAPLYKDLKKRQPDAAIGVRPRGPLAFQVADRMAYISDALFLEAMHAQGLDPESEGEG
DIELGVEPVKLDVLPAAQAHAVVKWVLTEGDPKENFPGPEWLHQPDGYSDREWILAIATE
YRRLVRAEHRS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcctgggttattgccgggctgctgggtatggcgacgggtctgcgcatcgggtgg
gtgctcgtccacaagcaatccccggtcagcaccggaatgattgtcgccctgggaagcctg
gcactggtatcggcgctgaactgggaaccgctgacgatcttggtggacagctcgctgggt
tggcccaacatctcggtagcgctgagccaggccgccttgacggcttgcgcggccggcagt
tgcgtgatgatcacgagcatgtccgccagccgtaccgcggtggccaacaagcgatgggcg
cgctggcagtacctggccgccaccgtgattggcggcgcgagcctcgcggtgttcttctcc
cgtggccggcagccggagatgacccctcgtgaatttctgaagcgcgatctgggtggattt
gcatccggcacggcctggttggtccccatgctgtacatcgcggtggccctgtcggtggtg
ctgtgggcggggatggcctattcgaatcggacccggcgcggtcgtgcccttttccttttc
actgtcgggatcagtctccttgtactggcagtgctggtggtggcgggcgtcgcggtggcc
cagtccgaatatgtcaccatcggtaccgcggccacattgatcggctgtgcgatggcgatg
gtggcagtgggcgcgctgctaccaacatttgaaacctggctggtcgcgcgacgcgagatg
tttgtgctggccccgttgtacaaggacctgaagaagcgccagccggacgccgcgattggt
gtgcggccccgtgggcctttggccttccaggtggcggaccgcatggcctatatctcggac
gcgctcttcctggaggcgatgcatgcccagggcctcgaccccgaatcagagggtgagggc
gatatcgagctgggtgtggagcccgtcaaactcgatgtgcttcccgcggcgcaggctcat
gccgtagtgaaatgggttctcaccgaaggtgatccgaaggaaaacttcccaggcccggaa
tggctacaccagcctgacggatactccgatcgcgaatggattctcgcgatcgctaccgag
taccgcaggctggtgcgtgccgaacatcgttcttga

DBGET integrated database retrieval system