KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0117cHelp
Entry
MAB_0117c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5962660
NCBI-ProteinID: YP_001700871
UniProt: A0A0U1ATS3
Position
complement(117199..117732)
Genome map
AA seq 177 aa AA seqDB search
MATSSDQPIEIAPFHAGGSLRGFVVCGRWPDSTKEWMQLLIVTVRIATLPGLLSTTTIFG
AREDLPDDPAPGMVGLVIAEGTVLGESAVAPGRFAEHQPPALLMLHPPSETNPTLPECLG
AASGCLLLPGIPHLGLDHRAAWVEAESDGTVTSVVSRVGIDPISDPDTAVLAMLLAA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccagttccgatcagccgatcgagatcgcgcccttccatgcgggcggatcactc
agagggtttgtggtgtgcggccggtggcctgattccacgaaggaatggatgcagctgctg
atcgtgacggtacgcatcgccaccctgcccggattactctccaccacaacgatttttggc
gcccgtgaagacctaccggacgacccggcacccggcatggtgggcttggtcatcgccgaa
ggcacggtccttggtgaatcggcagtcgcccctgggcgtttcgcagagcatcagccgccg
gcgctgctcatgctccaccctccgtcggaaaccaatccgacactgccggaatgcctaggc
gcggcgtccggttgcctcctcctacccggaataccgcatctgggcttggaccatcgggcc
gcctgggtggaggcagagtcggacggcacggtcacttcggtggtgagccgggtcggtatc
gatcccatcagcgacccggacacggcagtattggcaatgctgcttgccgcatag

DBGET integrated database retrieval system