KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0118cHelp
Entry
MAB_0118c         CDS       T00657                                 

Definition
(RefSeq) Probable superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MAB_0118c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 5962661
NCBI-ProteinID: YP_001700872
UniProt: A0A0U1AVW0
Position
complement(117899..118522)
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGVNDAVAKLEEAREKGDHAAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGDLAAAIDDQFGSFDKFQAQFTAAANGL
QGSGWAVLGYDSLGQKLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQDRYTAATTKTSGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagtacacactgcccgatttggactatgactacggagcgctggagccccacatc
tcgggacagatcaacgagctgcaccacagtaagcaccacgcgacctacgtcaagggtgtt
aacgacgctgttgccaagttggaggaggcccgcgaaaagggcgaccacgccgcgatcttc
ctcaacgagaagaacctggcgttccacctcggcggccacgtgaaccactcgatctggtgg
aagaacctgtcccccaacggcggtgacaagccgaccggcgatctggccgccgccatcgac
gatcagttcggttcgttcgacaagttccaggcacagttcaccgccgcggccaacggtctg
cagggctcgggctgggccgtgctcggttacgacagcctcggacagaagctgctgaccttc
cagctgtacgaccagcaggccaatgtccctctgggcatcatcccgctgctccaggtcgac
atgtgggagcacgccttctaccttcagtacaagaacgtcaaggccgactacgtgaaggca
ttctggaacgtggtcaactgggccgacgtgcaggaccgctacaccgcggccaccaccaag
acgtcgggcctgatcttcggctga

DBGET integrated database retrieval system