KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0122Help
Entry
MAB_0122          CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4328 HypA DZR OrfB_Zn_ribbon
Motif
Other DBs
NCBI-GeneID: 5962665
NCBI-ProteinID: YP_001700876
UniProt: A0A2C9Y8I2
Position
120459..121622
Genome map
AA seq 387 aa AA seqDB search
MIQVCSRCGTQWNVREQRRYWCPRCRGTLLEPGMTAPPRPAASMSRPPVGAPAPAGKYWV
PPTQQGPVATPAGRPQARPTRLPAGYRWIAVRPGSPPAPARRRRPLGPTPRYAYIPRWGL
VDHIEPTGSSRQGIAGGAVPSRILDRLLLATIITLAITSCTHFLRYALMVYNRGALIPRF
VASASNGLVLISVALAFAVMAATAWFLTDWMIARRAETYRDLGFDDPRSPWEIRVLCLLP
IANIVGIPLLLLELAKIENRWYRQYRNIMWWTVLWAATWLLALVTWVVRDSVTVQGIADN
ALFTAIDYAVAAVAAWRLRRVYEGFTAPEGHHRAVRWLAVESPQGPVPLDADRPDVPPTR
DANSGAAVEPVGTEPAALDRDRVVGAW
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatccaggtgtgctcccgctgcgggacccagtggaacgtgcgtgagcagcgtcgatac
tggtgcccacgatgccggggcactctgcttgagccgggcatgaccgccccgccgcggccc
gccgcgtccatgtcacgcccgcccgtcggggcacccgcgcccgccggcaagtattgggtt
ccgccgactcagcagggccccgtggcaacgcctgcgggacgtccacaggcgcgtcccacc
cggctgcccgcgggatatcgatggattgccgtgcgtcccggatcgcccccggcgccggcc
cgccgacgtcgtccgctcgggccgacgccgcgctacgcgtatatccctcgctggggtctg
gtcgaccacatcgagccgaccggatcgtcacgccaagggatagccgggggtgctgtcccc
agccggatactcgacaggctcctgctggccacaatcatcaccctggcaatcacttcatgt
acgcattttcttcgatatgcgttgatggtctacaaccgcggtgcactgatcccgcggttc
gtcgccagtgcgtcaaacgggctagtcctgatcagcgtggcgcttgccttcgcggttatg
gcggccaccgcgtggttcctgacggactggatgatcgcgcgccgtgcagaaacctatcgt
gacctggggttcgacgatccgcgcagcccatgggagattcgggtgctgtgcctgctaccg
atcgcgaacatcgtgggtataccgctacttctcctggagctcgccaagatcgagaaccgt
tggtatcggcagtaccggaacattatgtggtggacggttctgtgggcggcgacgtggctg
ctggccctggtgacgtgggtggtccgcgattcggtgacagtgcagggcatcgcggacaac
gcgctcttcacggccatcgattacgcggtcgcggcggtcgcggcctggaggcttcgtcgc
gtgtacgagggcttcacagcaccggaaggacatcaccgcgcggtgcgctggctggcggtg
gaatccccgcaggggccggtgccgctggatgccgaccgtccggacgtgccgccgacacgc
gacgccaattccggcgctgcggttgaaccagtgggcacggaaccggcagcattggatcgt
gaccgagtcgtcggagcctggtga

DBGET integrated database retrieval system