KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0123Help
Entry
MAB_0123          CDS       T00657                                 

Definition
(RefSeq) Putative glycerophosphoryl diester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MAB_0123
Enzymes [BR:mab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     MAB_0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDPD
Motif
Other DBs
NCBI-GeneID: 5962666
NCBI-ProteinID: YP_001700877
Position
121597..122460
Genome map
AA seq 287 aa AA seqDB search
MTESSEPGEDEAHARGADGIDGRGERHPFVVAHRGASADRPEHTLAAYELALEEGADGVE
CDVRLTRDGQLVCVHDRRVDRTSDGTGLVSEMTLSQLRALDFGSWHPGGAEAETGTGLLT
LEELVSLVLDWNRPVKLFIETKHPVRYGSLVENKVLALLHRFGIAAPASADMSRAVVMSF
SAAAVWRIRRAAPMLPTVLLGETSRYLGGSAATTVGATAVGPSIATLREHPELVDRAAAQ
GRATYCWTVDHYEDVEFCRSIGVAWIATNHPGRTKSWLQRGLTGTTL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagtcgtcggagcctggtgaggatgaggcccatgcacggggagccgacggtata
gacggcaggggcgaacgccatccgttcgtcgtcgcgcatcggggcgcgtcggcggaccgg
cccgagcacactcttgcggcgtatgagcttgccctcgaagagggggccgacggagtcgag
tgcgatgtgcgcctcacccgggacggacagctggtgtgtgtgcatgaccgcagagtcgac
cgcacctcggacgggaccgggttggtcagtgagatgacactgagccagctgcgcgcattg
gatttcggcagctggcatccggggggtgccgaggcagagacgggcacggggctgctgact
ctcgaggaactggtttccctggtactcgactggaaccgcccggtgaagttgttcatcgaa
accaagcacccggtccggtacgggtcgttggtcgagaacaaggtgctcgcgctgctccac
cggttcggcattgcggcaccggcatcggccgatatgtcacgggcggtggtcatgtcgttc
tcggccgccgcggtatggcgcatccggcgtgcggctccgatgctgcccaccgtgctcctc
ggcgagacctccaggtatctcggcggcagcgcggctaccactgtgggggcgacggcggta
ggaccgtcgatagccaccctgcgtgagcatccggagctggtggacagggcggcggcccag
ggccgcgcgacatactgctggacggtggatcactacgaagatgtcgaattctgccggagc
atcggtgtcgcctggatcgccaccaaccacccgggccgcaccaagtcctggttgcagcga
gggcttaccggtaccacgttgtaa

DBGET integrated database retrieval system