KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0124Help
Entry
MAB_0124          CDS       T00657                                 

Definition
(RefSeq) Conserved hypothetical protein (GGDEF domain)
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF
Motif
Other DBs
NCBI-GeneID: 5962667
NCBI-ProteinID: YP_001700878
UniProt: A0A2C9YBM4
Position
122517..123587
Genome map
AA seq 356 aa AA seqDB search
MGAGEMTFGQEYRFATRALTVTRNLVPLKIAIGLLCLSIVVLGTLIQFHPLGPHGLWPRL
IHGVLVASALVVGMCWVVLPWPRRRVAIAFVWWADISMVVGACTLSAPASRLGALAHMGL
IGVFAAFLLGWRVLAVHCVFATVAIFGLMGWNVRLGEATWFDQYVYSAPALSSVVLLPII
IQVVVEGGRRSLKAISLAAHQDPLTGLLNRRGVQVALSSLLSGQRATRIVAVVLVDVDEL
KELNDRLGHDAGDESIRAVAAMLATTTRASDLTARMGGDEFMVVGFFDHADEATGLIERI
GARRFGIGPHRASVSMGSAMRSTSVAGFDFESLRRAADEELRGAKIERRNGFHAVP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgccggcgagatgacgttcggtcaggagtaccgattcgcgacgcgcgcgctcacg
gtcactcgcaacctggtgccgctcaaaatcgcgatcggactgctgtgcctgtcgattgtg
gtgttggggacactcatccagttccacccgctgggaccgcatgggttgtggccgaggctt
attcacggtgtgctggtggcgtccgcacttgtggtcgggatgtgctgggttgtgctgccc
tggcccaggcggcgtgtggcgatcgcattcgtctggtgggccgacatctcgatggtcgtc
ggagcctgcacgctgtcggcacccgcatcgcgactgggcgccctcgcgcatatgggcctg
atcggagttttcgccgcgtttctgctgggatggcgagtgttggcggtgcactgcgtcttc
gcgacggtcgcgatcttcggcctcatgggctggaacgtccgactcggcgaggcgacgtgg
ttcgatcagtacgtctacagtgcgcccgcactgtcctcggttgtcctgctacccatcatt
attcaggtcgtcgtcgagggcggtagacgctccctgaaggctatatcgcttgctgcgcat
caagatccgctgaccgggctattgaaccgtcgtggcgtacaggtggcgctgagctccctg
ctgtccgggcagcgggcaacccgaattgtcgcggtggtgctcgtcgacgtggacgagctg
aaagagctcaacgacaggctggggcacgacgccggagacgaatccatccgcgccgtcgcg
gcaatgctggccaccacgacccgggccagtgatctcaccgcgcgtatgggcggcgatgag
ttcatggtggtgggcttcttcgaccatgccgatgaggcgacaggcctcatcgaacgcatc
ggggccaggcgattcggcatcggtccacaccgggccagcgtcagcatgggatctgccatg
cgatccaccagcgtggccggcttcgacttcgagtcgctgcgccgggcggcggatgaggag
ctgcggggagcaaagatcgagcgccgcaacggctttcacgcggttccctag

DBGET integrated database retrieval system