KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0126cHelp
Entry
MAB_0126c         CDS       T00657                                 

Definition
(RefSeq) Possible bacterioferritin BfrB
  KO
K22336  bacterioferritin B [EC:1.16.3.1]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAB_0126c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.1  ferroxidase
     MAB_0126c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferritin Rubrerythrin kleA_kleC
Motif
Other DBs
NCBI-GeneID: 5962669
NCBI-ProteinID: YP_001700880
UniProt: A0A142QML6
Position
complement(124627..125172)
Genome map
AA seq 181 aa AA seqDB search
MTATDTPKTKFNALLHDQIGHEFTASQQYIAIAAYFDDADLPQLAAHFYKQAVEERNHAM
MIVRYLIDRRVSVEIPPVGAVTNGFTAPREPLALALAQEQTVTEQVTQLARTARDEGDYI
GEQFMQWFLKEQVEEVALMDTLLTVAERAGDNYFDLEEFVAREISVVESDPTAPPAAGGA
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaccgacaccccaaaaacgaaattcaacgcgcttcttcatgaccagatcggc
cacgagttcacggcatcgcagcaatacattgcgattgccgcttatttcgatgatgccgat
ctcccgcagctcgccgcgcatttctacaagcaggcggttgaagagcgcaaccatgcgatg
atgatcgtccggtacctgatcgaccggcgcgtatccgtcgaaatccccccggtgggggcg
gtgaccaatgggttcaccgcgccacgcgaaccgctggcgctcgcgctggcccaggagcag
accgttaccgagcaggtcacacaactggcacgcaccgcacgggacgagggcgactacatc
ggcgagcagttcatgcagtggttcctcaaggaacaggtcgaagaggtcgcgctcatggac
accctgctcacggtcgcggagcgggccggagacaactacttcgatctcgaggagttcgtg
gcgcgcgagatctcggttgtggagagcgaccccaccgcgccgccagccgcgggcggcgcg
ctctaa

DBGET integrated database retrieval system