KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0145cHelp
Entry
MAB_0145c         CDS       T00657                                 

Definition
(RefSeq) Probable transcriptional regulator, TetR family
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-GeneID: 5962688
NCBI-ProteinID: YP_001700899
UniProt: A0A0U1ASC1
Position
complement(142855..143487)
Genome map
AA seq 210 aa AA seqDB search
MSGQRQRVSRAESQQRTREELLDAAEELFLANGLGGTTVTKIAEAAGRTVGAIYSNFSSK
ENLCAEVLLRCYMRTFSEVAGRLIQSASSVDEQITELAQWSASLGGDEGLVALAAEYALA
IHKDQVQLAVSQGHIEMGRGLLAAVLANALPDDVSDDDRDAALTAVLATAVGLALGRTLG
TIDEQQYVDLLTRTLRLWIADLRRSAHISS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggccagcgtcagcgggtcagccgcgccgaatctcagcaacgcactcgtgaggaa
cttctggatgccgcagaagagctgttcctcgcgaacgggctcggcgggacaaccgtcacc
aagatcgccgaagccgccggccgcacggtcggcgcgatctactcgaatttctccagcaag
gaaaacctctgcgccgaggtgctgctgcgctgctacatgcggaccttctcggaagtcgcg
ggcaggctcatccagtcagcctcgtccgtcgacgaacagatcaccgaactcgcgcagtgg
tcggcgtcgctggggggagacgagggcctggtggcactggctgcggagtacgcgctggcc
atacacaaggatcaggtgcagctggccgtctcgcagggccatatcgagatgggtcgcggg
cttctcgcggccgtactcgcgaacgctcttccggatgacgtctccgacgacgaccgcgac
gcagcgctcacggcggtcctggcaaccgcggtgggattggcgctcggccgcaccttggga
accatcgacgaacagcagtacgtcgacctactgacccggacgctgcggctttggattgcc
gatctgcgccggtccgcgcacatctctagctaa

DBGET integrated database retrieval system