KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0146Help
Entry
MAB_0146          CDS       T00657                                 

Definition
(RefSeq) Putative magnesium transport MgtC family protein
  KO
K07507  putative Mg2+ transporter-C (MgtC) family protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
KEGG Orthology (KO) [BR:mab00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mab02000]
    MAB_0146
Transporters [BR:mab02000]
 Other Transporters
  Others
   MAB_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtC
Motif
Other DBs
NCBI-GeneID: 5962689
NCBI-ProteinID: YP_001700900
UniProt: A0A2C9Y8J0
Position
143651..144400
Genome map
AA seq 249 aa AA seqDB search
MALADSVAMFGGAGQGGRQLVGLLAAFVLSGIIGLEREIAGKSAGLRTQTIVGTSAALIL
LVSKYGFDDVLADGIVILDPSRVAAQIVSGIGFLGAGIIIMRRGAVHGLTTAAAIWESAA
VGMAAGAGLLLLAMVVTVLHFATVFGLAALGRLLTARLHGAVSLHVTYADGRGVLRQLLN
ACNAHRWSLLALSADPPAAPQTTDSISPGTAREVGVVMTLSGTRLDAATNVLAAVDGVHR
IDRLGDDIE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcggattctgtggcgatgttcggtggtgcgggccagggcggtcggcaactt
gtcgggctgctggccgcgttcgtgctatcggggattatcggcctggaacgcgagatcgcg
ggtaagagtgcgggattgcgcacacagacgattgtcgggacctccgcggcgctgatctta
ttggtgagcaaatacggttttgatgatgtgctggccgacggcatcgtgatccttgacccg
tcacgcgttgcggcgcagatcgtttcgggtatcggttttctgggcgccggaatcatcatc
atgcgccgcggggcggtgcacgggttgaccacggcggcggcgatatgggaatcggcggcg
gtgggcatggccgcgggcgccgggctactgctgctggcgatggtggtgactgtcctgcat
ttcgcaacggtattcggattggcggccttgggccgactgctcaccgcgaggctgcatggc
gctgtcagcctgcacgtcacctacgcggacggccggggtgtcctgaggcagctgctcaac
gcctgcaatgcacaccgctggtctttgttggcattgtccgccgacccaccggccgcgcct
cagaccaccgactcgatcagccctggcaccgcgcgtgaggtcggcgtggtgatgaccttg
tccggcacaagacttgatgccgcaacgaatgtgcttgcggcggtggacggtgtacatcgc
atcgaccggcttggcgacgatatcgagtag

DBGET integrated database retrieval system