KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0147cHelp
Entry
MAB_0147c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ESX-1_EspG PQQ_2
Motif
Other DBs
NCBI-GeneID: 5962690
NCBI-ProteinID: YP_001700901
UniProt: A0A0S1SX06
Position
complement(144411..145154)
Genome map
AA seq 247 aa AA seqDB search
MTVRLDFDELELTREITGNDLLPVVLAAGPRHEDEAEHRDALESARARLKERNLLKGEDL
HPTLRDMLTSASKATGQVAVRRWAGSQMLRLCLVEHGEAYVLLVNDGEGVAMRSVTGSLG
AELWRYLGDATPLKFGSINAPAEQLALALNSEPADMARQLMALGATKADAVTVAKGMARR
GAMTEITAIRRVDGVTDRAPGGVAVYDTAFGRIMATPSTSADGALWATLTPATPQRMTHA
LKSLGLE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtccgcctggacttcgacgaactggagctgacccgcgaaatcaccggcaatgac
ctcttgccggttgtgctggccgccggtccgcgccacgaagacgaagccgaacaccgagac
gcactggaaagcgcgcgtgcccggctcaaggaacgcaacctgctgaagggtgaagacctt
cacccgactctgcgtgacatgttgacctcggccagcaaggccaccggtcaggtggcggtg
cgccgctgggcgggatcgcagatgctgcgcctgtgcctcgtcgagcatggggaggcatac
gtactgctggtcaacgacggcgaaggcgtcgctatgcggtcggtgaccggatcgctcggt
gccgagctatggcgctatctcggcgacgccaccccgctgaagttcgggtcgatcaacgca
ccggccgagcagctggcgctggcgctcaattccgaacccgccgacatggcccgccaactc
atggcgctcggggccaccaaggccgacgcggtgacggtggcgaagggcatggcacgtcgc
ggcgcgatgaccgaaatcaccgcgatcagacgcgttgatggcgtcaccgatcgcgcaccc
ggcggagtcgcggtatacgacacagcatttggacgaatcatggccaccccaagcacgtcc
gccgacggtgccctgtgggccacactcacccctgccacgccgcagcggatgacgcacgcc
ctcaagagcctcggtttggaatag

DBGET integrated database retrieval system