KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0149cHelp
Entry
MAB_0149c         CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PE WXG100 T7SS_ESX_EspC Paf1 DcrB
Motif
Other DBs
NCBI-GeneID: 5962692
NCBI-ProteinID: YP_001700903
UniProt: A0A0U0XME2
Position
complement(146195..146566)
Genome map
AA seq 123 aa AA seqDB search
MADVPAPAQREEIRWDLANQPGTVLQVDPDVMKDAAVEYDAMAQRLQEALDKQLETAKFG
SAGRDEVSTAVSHASAKTNENFEKVAKDGIEQLKRIAEAFRRNSQAFVDLEHHNAARING
VGE
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgtaccggcgcccgcccagcgtgaggagatccgttgggacctggctaaccag
ccgggaactgttctgcaagtcgatccagatgtcatgaaggatgccgccgtcgagtacgac
gcgatggcgcagcgactgcaggaagctctcgacaagcagctcgagaccgccaagttcgga
tccgcgggccgcgacgaggtgtccaccgcggtatcacacgcctcggcgaagaccaacgag
aatttcgagaaggttgccaaggacggcatcgagcagctcaagcgcatcgccgaagcattc
cggcgtaactcgcaggcgttcgtggacctggagcaccacaacgccgcccgtatcaatggt
gtgggggaatag

DBGET integrated database retrieval system