KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0150cHelp
Entry
MAB_0150c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zincin_1 GIT_SHD
Motif
Other DBs
NCBI-GeneID: 5962693
NCBI-ProteinID: YP_001700904
UniProt: A0A0U0XL28
Position
complement(146712..147062)
Genome map
AA seq 116 aa AA seqDB search
MPVQMGEQRFEELVSDALDAIPPQLAAAIDNVVVLVQDHHPEDPDLLGLYEGIALTERDS
FYAGALPDTITIYREPLLEMCSSEQEVVDEVTITVIHEIAHHFGIDDERLHQLGWG
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgcagatgggcgagcaacggttcgaagagctcgtgtccgatgctctcgacgcc
attccgcctcagcttgccgccgccatcgacaacgtggtggtgctggtgcaggaccaccat
ccggaggatcccgatctactcgggctgtacgaaggcatcgcactgaccgaacgcgacagc
ttctacgccggggcgctgccggacaccatcacgatctaccgcgagccgttgctggagatg
tgctccagcgaacaagaggtggtcgatgaggtcacgatcaccgtgatccacgagatcgct
caccattttggtatcgacgacgagcgcttacaccagctgggctggggctaa

DBGET integrated database retrieval system