KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0152Help
Entry
MAB_0152          CDS       T00657                                 

Definition
(RefSeq) Putative ankyrin-like protein
  KO
K06867  uncharacterized protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 5962695
NCBI-ProteinID: YP_001700906
UniProt: A0A2C9YAW7
Position
148859..149305
Genome map
AA seq 148 aa AA seqDB search
MTTMEPDRDNPDDQAGEAEHQARVAEQVAALAHELFNMAREGNASTLAAYLDAGAPVDLT
NEAGDTLVMLAAYHGNASTVRSLVARGADVNRANDKGQTPLAGAVFKGSDDIVQILVNAG
ADPAAGTPSALDAARMFGKDGYLSLFGA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacgatggaacctgaccgtgacaacccggacgaccaggcgggggaagccgaacat
caggcccgcgttgccgagcaggtcgcagcgctggcccatgaactgttcaacatggcccgg
gagggtaacgcgtccaccctggccgcctacctcgacgcgggcgcaccggtggatctgacg
aatgaggcgggtgacacgctcgtcatgctggccgcgtaccacggaaacgcctcgacggtg
cgatcgctggtagcgcgcggagccgacgtgaaccgggccaatgacaaggggcagacgccg
ctggctggagcggtgttcaagggctccgacgacatcgtccagatcctggtcaatgcgggc
gccgaccccgccgcgggcacgccgtctgcgctcgacgccgcgcggatgttcggcaaggac
gggtatctgagcctgttcggtgcctaa

DBGET integrated database retrieval system