KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0157Help
Entry
MAB_0157          CDS       T00657                                 

Definition
(RefSeq) Hypothetical transcriptional regulator, MarR
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HxlR HTH_34 HTH_20 HTH_5 HTH_IclR TrmB PadR
Motif
Other DBs
NCBI-GeneID: 5962700
NCBI-ProteinID: YP_001700911
UniProt: A0A2C9Y8K1
Position
153616..154053
Genome map
AA seq 145 aa AA seqDB search
MSTTDGLTADVLTVIARLNRWVSSYADLPVPTGQARLLALVGEMEDARISDLAQADHCSQ
PTMTVQLKRLQDVGYVERRVDPADKRAQRIKLTSKGREALVAMRAQRQGVLDPWLSTLPA
EEQRTLAEAAAILERLTRRMAAQSG
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaccacagatggcctcactgccgacgtacttaccgtcattgcgcggctcaaccgc
tgggtatccagctacgccgatctacccgtgcccaccgggcaggcgcggctccttgcgctg
gtcggtgagatggaggacgcccggatctcagatctggcgcaagccgatcattgcagccag
cccacgatgaccgtgcagctgaagcggctgcaggacgtcgggtatgtcgagcggcgcgtc
gatcccgccgacaagcgcgcgcagcgcatcaagctgaccagtaagggccgcgaggcgctt
gtcgccatgcgtgcccagcggcagggcgtgctcgacccgtggctgagtacgttgcctgcc
gaagagcagcggactcttgccgaggctgccgcgatcctggagcgacttactcgccggatg
gcggcgcagtccggttag

DBGET integrated database retrieval system