KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0159Help
Entry
MAB_0159          CDS       T00657                                 

Definition
(RefSeq) Hypothetical 2-nitropropane dioxygenase
  KO
K00459  nitronate monooxygenase [EC:1.13.12.16]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MAB_0159
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.16  nitronate monooxygenase
     MAB_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO IMPDH FMN_dh PEP_hydrolase ThiG
Motif
Other DBs
NCBI-GeneID: 5962702
NCBI-ProteinID: YP_001700913
UniProt: A0A0U0XL04
Position
154907..155872
Genome map
AA seq 321 aa AA seqDB search
MTFNTRLTDRFGIEHPVVLAPMDDVADARLASAVSAAGGLGLLGGGYADADWVRQQFDQV
SAAVGCGFITWTLKGNEHVLEHALARGPAALFLSFGDPAPYAPRIRAAGVPLICQVHNIR
QAARAIEVGADVIVAQGGEAGGHGEGRRSTFTLVPEVVDLVAGTAPQILVLAAGGVTDGR
GLAASLALGADGVLVGTRFWAAGEAAISRAAQRHALQVGGDDTIRQHVYDIVRGKRWPSA
YSGRVLRNDFVDKWHRREAELAQHLDQARSEYQSGVAAEDYRTANLIVGEGIGQVRSVES
VADIIESMVAQAAAINSTSRS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaacacccggctcacggaccgcttcggcatcgagcatccggtggtcctggcg
cccatggacgacgtagccgatgcgcgcctcgcgagtgcggtcagtgccgccggtggactg
ggcctgctcggtggcggctacgccgacgcggactgggtgcgccaacagttcgaccaggtg
tccgccgcggtgggatgtggattcatcacctggaccctgaagggaaacgagcacgtcctg
gagcacgcactggcacgaggcccggccgcgctctttctgtccttcggggatcccgcgccg
tacgcaccccgtatccgggccgcaggtgtcccgttgatctgccaggtgcacaacatcagg
caggcagcgcgagcaatcgaggtgggcgctgacgtcatcgtcgctcagggcggagaagcc
ggcggacacggagaagggcggcgttccacgttcacgctggtgccggaggtcgtggacctc
gtcgccgggaccgcgccccagatcctggtgctggcagccggtggggtgaccgatggccgc
ggactggcggcgtcgctcgcgttgggggccgacggtgtgctggtcggaactcggttctgg
gctgcaggagaagccgcgatttcccgggccgcccagcggcatgcgctccaggtgggcggc
gacgacaccatccgtcagcacgtctacgacatcgtgcgcggcaagcgctggccgagtgcc
tacagcggccgggtactgcgcaacgatttcgtcgacaagtggcatcgccgcgaagccgag
cttgcccaacatcttgatcaggcccggtctgaatatcagagcggcgtggctgccgaggat
taccgcaccgccaacctgatcgtcggtgaaggtatcggacaggtgcgaagcgtcgagagc
gttgccgacatcatcgagtccatggtggctcaggccgctgccatcaactcgacatcaagg
agctga

DBGET integrated database retrieval system