KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0162cHelp
Entry
MAB_0162c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHAP DUF2272
Motif
Other DBs
NCBI-GeneID: 5962705
NCBI-ProteinID: YP_001700916
UniProt: A0A2C9YAX4
Position
complement(157190..157753)
Genome map
AA seq 187 aa AA seqDB search
MRPTTRRFLLLVALVATLVVVGGSAVGVYRSRTATPPFPVVDTVALSPGRAAVVRILGEE
YAAQAGMAKYSEGNDEPWCADFTSWVMRASGKPFSNPNSGHWRIPGVLTLTAYLRDAGRY
ETPSYAPEPGDMVLYDKPSPKGQHVNIVLINDKGTLTTVGGGEGRGVGLSTYVAADDSGI
TGYGRYE
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccaccactcgccggttcctgctgctggtagcccttgtcgcaaccctcgtcgtg
gtgggcggtagcgccgtcggcgtctaccgttctcgcacggcaacgccgccatttcctgtc
gtcgacaccgtcgcactgtccccgggacgtgccgcggtggtgcgcatcctcggggaggaa
tacgccgcccaggccgggatggcgaagtattccgagggcaacgacgagccctggtgcgcc
gatttcaccagctgggtgatgcgcgcttcgggcaagccgttctccaatcccaactccgga
cattggcgcatccccggcgtgttgacgctgaccgcgtacctcagggacgcgggacgctac
gagactcccagctacgcaccagaacccggcgacatggtgctgtacgacaaaccgagtccc
aaggggcagcatgtgaacatcgtgctcatcaacgacaaaggcaccctcaccaccgtcggt
ggcggggaaggccgcggcgtgggtttatctacctacgtggccgccgacgattccgggatc
accggatacggccgctacgagtga

DBGET integrated database retrieval system