KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0171Help
Entry
MAB_0171          CDS       T00657                                 

Definition
(RefSeq) galactofuranosyl transferase
  KO
K16650  galactofuranosylgalactofuranosylrhamnosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,5/1,6-galactofuranosyltransferase [EC:2.4.1.288]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
KEGG Orthology (KO) [BR:mab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mab01003]
    MAB_0171
Enzymes [BR:mab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.288  galactofuranosylgalactofuranosylrhamnosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,5/1,6-galactofuranosyltransferase
     MAB_0171
Glycosyltransferases [BR:mab01003]
 Polysaccharide
  Bacterial polysaccharide
   MAB_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Baculo_LEF5_C
Motif
Other DBs
NCBI-GeneID: 5962714
NCBI-ProteinID: YP_001700925
UniProt: A0A2C9Y8N3
Position
166052..168013
Genome map
AA seq 653 aa AA seqDB search
MTTMSDIPFGPIDSTESHAVSLLSRVILPRPGEPLDVRKLYIVESDTNDRRAHPPTRTSL
EIGSESEVSFATYFNAFPASYWRRWSTLENVVLHIELTGSGRIDVYRTKATGARITVGGT
QFSGDNAVIEFEIGLDAFEDGGWIWFDITTDSDVTLHNAGWYSPTAAPGRASIAVGIPTF
NRPNDCVNALKALTSDPLVDKVITAVIVPDQGTKKVKDHPEWAAASGPLEGRLRVHDQPN
LGGSGGYSRVMYEALKNTDCEQILYMDDDIRIEPDSILRALALNRFAKSPMLVGGQMLNL
QEPSHLHVMGEVVNRDNFMWTNAPFAEYDHDFAKFVLDDIEQDRSKLLHRRIDVDFNGWW
MCMIPRAVAEELGQPLPLFIKWDDAEYGLRANEHGYGTASMPGTAIWHMAWSDKDDAIDW
QAYFHLRNRLVVAALHWDNNIRGLLGSMIKATIKHLMCLEYSTVAIQNRAIDDFLAGPEH
IASILESAMPEVRALRQEFPDAVVLPTATSLPVPSGRRKVHRPPVSLPAIGFRLSRGVIH
QLTKENPAHHVRPQLNVATQDARWFLLCGMDGVTVTTADGRGVVYRQRDRARMFELLRGS
LRRNLQLMRSFNKMRKTYRKALPTLTSKEQWENILGIGKDNPAPQSMNPGVSA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacaatgagtgatattccattcggccccatcgattcgaccgaatcacacgcggtg
agcctgctgtcccgggtgatcctgcccaggcccggtgaacctctcgacgtgcgcaagctc
tacatcgtcgagtccgacaccaatgaccggcgtgcgcacccgcccacccgtacctcgttg
gagatcggctcggaatccgaggtttccttcgccacctacttcaacgcgttcccggcgagc
tattggcgacgctggtccacgctggagaacgtggtgctgcacatcgagctgaccggctcc
ggccgtatcgacgtgtaccgcaccaaggccaccggggcgcgaatcaccgtgggcggcacc
cagttcagtggcgacaatgcggttatcgaattcgagatcggtctggatgccttcgaagac
ggcggctggatctggttcgacatcaccacggacagcgacgtcacgctgcacaacgcgggc
tggtactcgccgaccgccgcgcccggccgggccagcattgccgtcggaatacccaccttc
aaccggccgaatgactgcgtgaacgcgctgaaggcccttacctcggatcctttggtggac
aaggtgatcaccgctgtcatcgttccggatcagggcaccaagaaggtcaaggaccacccg
gaatgggcggccgcctccggtccgctggagggccggctgcgggtgcatgaccagcccaac
ctcggtggttcgggcggctacagccgggtcatgtacgaggcgctcaagaacaccgactgc
gagcagatcctctatatggatgacgatatccgcatcgagccggattcgatcctgcgggcc
ttggcgctcaatcgatttgccaagtccccgatgcttgtcggcggtcagatgctcaatctg
caggagccctcgcacctgcacgtgatgggcgaggtcgtcaatcgtgacaacttcatgtgg
accaacgcgccgttcgccgaatacgaccacgacttcgccaagttcgtgctcgacgacatc
gaacaagaccgcagcaagctgttgcaccgccgcatcgacgtcgacttcaacggctggtgg
atgtgcatgatcccccgcgctgtcgccgaggagctgggccaaccgttgccgctgttcatc
aagtgggatgacgccgagtacgggcttcgcgccaacgagcacggctacggcacggcgtcg
atgccgggtaccgcgatctggcacatggcgtggagcgacaaggacgacgccatcgactgg
caggcctacttccacttgcgtaaccgattggtggttgctgccctgcattgggacaacaac
attcgcggtttgttgggcagcatgatcaaggccaccatcaaacacctgatgtgcctggag
tactcgacggtcgccatccagaaccgggccatcgacgacttcctggccgggccggagcac
atcgcctccatcttggagtcggcgatgcccgaggtacgggcgctgcgccaggaattcccg
gatgccgtggtgctgccgaccgctacctcgctgccggtgccgtcgggacgccgtaaggta
cacaggccgccagtatcgttgcctgccatcggattccgcctgtcgcggggcgttatccac
cagctgaccaaggaaaaccccgcgcatcatgtgcgtccgcaactgaacgtcgcgacccag
gacgcccgctggttcctgctgtgcgggatggacggcgtcacggtcaccaccgccgacggg
cggggtgtggtgtaccgccagcgcgaccgcgccaggatgttcgaactgctgcgcgggtcg
ctgcgccgcaacctgcagctgatgcgtagtttcaacaagatgcgcaagacctaccgcaag
gcgttgccgacactgaccagtaaagaacagtgggagaacatccttgggatcggcaaggac
aacccggcgcctcaatccatgaaccccggggtgagtgcatga

DBGET integrated database retrieval system