KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0173Help
Entry
MAB_0173          CDS       T00657                                 

Definition
(RefSeq) UbiA prenyltransferase family protein
  KO
K14136  decaprenyl-phosphate phosphoribosyltransferase [EC:2.4.2.45]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
KEGG Orthology (KO) [BR:mab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mab01006]
    MAB_0173
Enzymes [BR:mab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.45  decaprenyl-phosphate phosphoribosyltransferase
     MAB_0173
Prenyltransferases [BR:mab01006]
 Compound prenylation
  DPPR synthase
   MAB_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA SseC
Motif
Other DBs
NCBI-GeneID: 5962716
NCBI-ProteinID: YP_001700927
UniProt: A0A0U0YAA3
Position
168570..169484
Genome map
AA seq 304 aa AA seqDB search
MSEEAAPTVGPPKNLVSGIVKAVRPRQWVKNILVFAAPLAALGDIPPHDYRTVFTKVAIA
FVVFSMAASSIYLINDARDVEADRQHPTKRFRPIAAGVLPVPAAYGLSVVLAAGSLAIAS
QVNANLVVVIAIYIAIQLGYCFGLKHQPVIDICIVSSAYLIRAIAGGVAAGVYLSQWFLL
IMAFGSLMMTAGKRYAELQIVEKTGAKIRKSLEGYTASYLRFVWTLAATAVVVCYGLWAF
ERDHRAGSWFVASMIPFTIAVLRYAVDVDGGEAGEPEEIALGDRVLQFLFVAWIGSLGAA
FYFS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggaagcagctccgaccgtggggccgcccaagaaccttgtctcggggatcgtc
aaggcggtccgccctcggcagtgggtgaagaacatcctggtcttcgcggcgccgttggcg
gccctcggcgacattccgccgcacgactaccgcacggttttcaccaaggtcgcgattgca
ttcgtagtgttcagcatggcggcgtcgtcgatctacctgatcaacgacgcccgcgatgtc
gaagccgaccgccagcaccccaccaagcgcttccggccgattgccgcgggggtgctgccc
gtaccggccgcctatgggctttcggtggtgctggccgccggatccctggccatcgcgtca
caggtcaatgcgaacctcgtggtggtcatcgcgatctacatcgcaatccagctgggttac
tgcttcggcctgaaacaccaaccagtcatcgacatctgcattgtgtcgtcggcctacctg
atccgtgccatcgccggaggtgtggccgccggtgtgtatctgtcgcagtggttcttgctg
atcatggcctttggatcgctcatgatgaccgcgggtaagcgctacgccgagctgcagatc
gtggagaagaccggcgcgaagatccgcaagtcgctcgagggatacaccgcgagctacctg
agattcgtctggaccttggccgccacagccgttgtggtctgttacgggctgtgggccttc
gaacgcgaccaccgggccggctcctggtttgtggcttcgatgattccgttcaccatcgcg
gtgctgcgttacgcggtggacgtcgacgggggcgaggcgggggagcccgaggagatcgct
ctgggggacagggtgcttcagttcctgttcgtcgcatggatcggatcgctcggtgcggcc
ttctacttctcctga

DBGET integrated database retrieval system