KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0180Help
Entry
MAB_0180          CDS       T00657                                 

Definition
(RefSeq) Polyketide synthase PKS13
  KO
K12437  polyketide synthase 13
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
KEGG Orthology (KO) [BR:mab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mab01004]
    MAB_0180
Lipid biosynthesis proteins [BR:mab01004]
 Polyketide synthase
  Modular PKS
   MAB_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C PP-binding Thioesterase KAsynt_C_assoc Thiolase_N DUF2974 WHG
Motif
Other DBs
NCBI-GeneID: 5962723
NCBI-ProteinID: YP_001700934
UniProt: A0A2C9Y8R8
Position
178481..183829
Genome map
AA seq 1782 aa AA seqDB search
MTDTQQDSTPETSLETPAPEVAAPTGGAGLTVPEMREWLRNWIAKATGVSPDRIDDSAPM
VEMGLSSRDAVAMAADIEDLTGVTLTATVAFQHPTIESLATRIIEGEPEVPDAGDEDWSR
DPKIAAGEFDIAVVGLSARLPGDVNSPAQLWEALLEGRDAITDLPEGRWEEFTAEPRIAE
RVAQAATRGGYLKDIKGFDAEFFTLSKMEADNMDPQQRIALELTWEALENARIPASSLKG
ESVGVYIGSSNNDYSYLSVADPTVTHPYAITGNASSIIANRVSYFYDFRGPSVAVDTACS
SSLVAVHQGVKALRSGEADVVVAGGVNALITPVVTVGFDEVGGVLAPDGRIKSFSQDANG
YSRSEGGGMLVLKRLSDARRDGDPIMAIIAGSAVNHDGRSNGLLAPNPDAQAEVLRKAYK
DAGIDPRSVDVIEAHGTGTILGDPIEADGLGRVVGRGRDADKPALLGSAKSNFGHLESAA
GAASLSKIVLALQNNKVPPSINYTGPNPYIDFDAIHLKVVDQVSEWPRYSGHAIAGVSGF
GFGGANAHIVVREVLPIDLVEPSESTEPESDDADTNGKHAVAEADTADGDEFSVSRFDEY
GEFTGGYSDEPYELPGLTDEAKRLKEEGLAALAAEEPVAPVVPLFISGFLSSRKKAAAAA
LADWMETEEGQSYSLESIGRSLSRRNHGRSRAVVLAHDHEEAIKGLRAVAEGKQKPYVYS
ADGPVSNGPVWVMAGFGAQHRKMGKSLYLRDPIFAEWIDKVDSYVQEERGYSVVELILDD
SHEYGIETSNIAIFAIQIGLGEVLKAHGAKPTAVIGQSLGEPASAYFAGGLSLADATRVI
CSRAHLMGEGEAMLFGDYIRLMALVEYSADELKTVFADFPDLEVCVYAAPSQTVIGGPPA
QVDAIVARCEAEGKFARKLQTKGAGHTSQMDPLLGEFAAELQGIEPMSPKIGIFSTVHEG
TFIRGGGEPVHDVDYWKKGMRHSVYFTHGTRNAVDAGHTTFLELAPNPVALMQVGLTTMA
SGLPDAQLIATLARKEDEVESMVKAMAQLYVHGHALDPRTLFSRAAKSSDYAPIPATEFK
RKPHWLPAHFSADGSTRIPGTHVSLPDGKHVWEWSPREVAGVDFAELVKTAATSVLPGAQ
LTAFEQRAIPGEGSTLVTTLSRHPGGATVQVHARIGESFTLVYDAVVSRAGQGGALPFAT
AAGVATNGSAVVSASAAPSHAVAVVEEEVPEEIHDNLLSGAGAGADFKKWSKESGEPVID
RLATIVSMAMGYEPEDVPREVPLIELGLDSLMAVRIKNRVEFDFDLPPIQLQAVRDANLL
DVERLVIYALENPDAVHELHDYQQTDEFKAAAPTGGMLSKADIEAALTAGAAESVPAEVP
AAEPAADSAPPAIAQEATISAETSELAKAAAAMNQEAIAEALNADVPPRDAAERVAFATW
AIVTGESPGSIFNALPKIDDATAEKLAERLSQRADGEIPAEEVKLAPTIEALGEVVRSRL
EAGKIDGFVRTLAPRQEGSTAVPVFVFHPAGGSTVVYEPLLKRLPEGTPMFGFERVEGTI
EERAAKYVPKLMELHDGPFILAGWSLGAVLAYACAVGLKEAGAEVAWVGNIDGVRPGTPI
LQTKEETRKRWDRYAAFAQKTFNVEIPAIPYEQLEELDDAGQVTFVLEAVKASGVQIPGG
IIEHQRTSYLDQRAIDTSTPVKFDGHMTLYMADRYHDDAITFEPAYATRQPDGGWGEFVS
DLEVVPVGGEHIQVIDEPIIAKVGAHMSQALRTINAQQAQQA
NT seq 5349 nt NT seq  +upstreamnt  +downstreamnt
atgactgatactcaacaggattcgacaccagagaccagcctggaaaccccagctccggag
gtagcggcaccgaccggcggtgccgggctgaccgtgcccgaaatgcgcgaatggctgcgc
aattggatcgccaaggccaccggggtgagcccggaccgtatcgacgactcggcgccgatg
gtcgagatgggtctgtcctcacgcgacgccgtcgcgatggccgccgacatcgaggacctc
accggggtcaccctcacggccaccgtggcctttcagcaccccaccatcgagtcgctggcc
acccgcatcatcgagggcgagcccgaggtgccggatgccggcgacgaggactggtcgcgc
gacccgaagatcgccgcgggcgaattcgatatcgcggtggtcggcctgtcggcgcgtctg
cccggcgacgtcaacagcccggcgcagctgtgggaggcgctgctggagggccgcgacgcc
atcaccgatctgcccgagggccggtgggaagagttcaccgccgagccgcgtattgccgag
cgtgtggctcaggccgccacccgcggtggatatctcaaggacatcaagggattcgacgcc
gagttcttcacgctgtccaagatggaagccgacaacatggatccgcagcagcggatcgcg
ctggaattgacttgggaggcactggaaaacgcccgtattccggcatccagcctcaagggt
gagagcgtcggtgtgtacatcggtagctccaacaatgactacagctacttgtcggtggcc
gatcccaccgtcacccatccgtacgccatcaccggtaacgcgagttcgattatcgcgaac
cgggtttcgtacttctatgacttccgtggcccgagcgtcgccgtcgacacggcatgttcc
tcgtcgctggtcgcggtgcaccaaggggtgaaggccctgcgctccggtgaggccgatgtc
gtggtggccggtggcgtcaacgcactcatcacgcctgtggtgacggtcgggttcgacgag
gtcggcggcgtgctggcgcccgatggccggatcaagtccttctcgcaggatgccaacggg
tacagccggtccgagggcggcggcatgctggtgctgaagcgtctctcggacgcgcgccgc
gacggcgacccgatcatggcgatcatcgcgggttcggccgtcaaccacgacggacgctcc
aacggcctgctggcccccaacccggatgcccaggccgaggtgctgcgcaaggcctacaag
gacgccggaatcgacccccgcagtgtcgatgtcatcgaggcgcacggcaccggcaccatc
ctgggcgacccgatcgaggccgatgggctcgggcgtgtggtcggccgtggccgcgacgcc
gacaagcccgcgctgctgggctcggcgaagtcgaacttcggacatctggagtccgcggcc
ggcgccgccagcctctcgaagatcgtgcttgccttgcagaacaacaaggttccgccgtcg
atcaactacaccggccccaacccgtatatcgacttcgacgcgattcatctgaaggttgtc
gatcaggtctccgaatggccgcgctacagcgggcacgccatcgcgggcgtctccggcttc
ggtttcggtggagccaacgcccacatcgtggtgcgcgaagtgctgccgatcgacctggtc
gaacccagcgaaagcactgagccggagtccgacgacgccgacaccaacggcaaacatgcg
gtggcagaggcggataccgctgacggcgacgaattctccgtctcgcgctttgacgagtac
ggcgagttcaccggcggctattccgatgagccgtacgagctgcccggcctgaccgatgag
gccaagcggctcaaggaagaggggctggcggcgctcgctgccgaagagccggtcgctccg
gttgtgccgctgttcatctcgggcttcctgtcctcacgcaagaaggccgccgcggcggcg
ctggcggactggatggagaccgaagaggggcagtcttactcactggagtccatcgggcgc
tcgttgtcgcgccgcaaccatggccgctcccgcgccgtggtgctggcccacgatcacgag
gaggccatcaagggccttcgtgcggtggccgagggcaagcagaagccgtacgtgtactcc
gcggacgggccggtgagcaatggcccggtatgggtgatggccggtttcggagcccagcac
cgcaagatgggcaagagcctgtacctgcgcgatccgatcttcgccgagtggatcgacaag
gtcgactcgtacgtgcaggaagagcgtggttactccgtcgtcgagctcatcctcgacgat
tcgcacgagtacggcatcgagaccagtaacatcgccatcttcgcgatccagatcgggctc
ggcgaggtgctcaaggcgcatggcgccaagcccaccgcggtgatcggacagtcgctgggc
gagcccgcgtcggcctatttcgcgggcgggctgtcgctcgccgacgcgacacgtgtcatc
tgctcgcgcgcccatttgatgggtgagggcgaggcgatgctgttcggcgactacatccgg
ctgatggcgctggtcgaatactcggccgacgaactcaagacggtgttcgccgacttcccc
gatctggaagtgtgcgtgtatgccgcgccgtcgcagaccgtcatcggtggtccgccggcg
caggttgacgcgatagtggcccgctgcgaggcggaaggcaagttcgcgcgcaagctgcag
accaagggcgcgggccatacgtcgcagatggatccgctgctcggcgaattcgccgccgaa
ctgcaggggatcgagccgatgtccccgaagatcggcatcttctcgacggtccacgagggc
accttcatccgcggcggcggggagccggtccacgatgtggactactggaagaaggggatg
cggcactcggtctacttcacccatggcacccgcaacgccgtggacgccgggcacaccacc
ttcctggagctggcgccaaacccggtggcgctcatgcaggttgggctaacgaccatggcg
tcggggctgccggacgcgcagctcatcgcgaccctcgcccgcaaggaggacgaggtcgag
tccatggtcaaggccatggcgcagctgtacgtgcacggtcacgcgctggacccgcgcacg
ctgttcagcagggcggccaagtcttccgactacgcgccgatccccgccaccgagttcaaa
cgcaagccgcactggctgcccgcgcatttcagtgccgacggatcgacccgcatcccgggt
acgcatgtgtcgctgcccgacggtaagcatgtatgggagtggagtccgcgggaggtcgcc
ggcgtcgacttcgctgaactggtcaaaaccgctgcgacatcggtgcttccgggcgctcag
ctcaccgcgtttgagcagcgcgccatcccgggcgaaggttccacgctggtgaccacgctc
tcccggcacccgggcggggccaccgtgcaggtgcacgcccgcatcggggaatcgttcacg
ctcgtctatgacgcggtggtgtcgcgtgccggtcagggtggcgcactgccgttcgcgact
gccgcgggggttgccaccaacggcagcgccgtggtgagtgcctctgcggcgccttcccat
gcggttgccgtcgtggaagaggaagtgcccgaagagattcacgacaacctgctgtccgga
gcaggcgcgggcgccgacttcaagaaatggagcaaggagtccggcgagccggtcatcgac
cggttggccaccatcgtgtcgatggccatgggttacgagcccgaggacgtgccacgcgag
gtgccgttgatcgagctgggtctggattcactgatggccgtgcggatcaagaatcgcgtc
gagttcgacttcgacctgccgccgattcagctgcaggccgtgcgcgacgcgaacctgctg
gacgtcgagcgactggtcatctatgccttggagaacccggacgccgtgcacgagttgcac
gactaccagcagaccgacgagttcaaggcggccgcgccgaccggcggcatgctgtcgaag
gccgatatcgaggcggccctgaccgcgggtgcggccgagtcggttccggctgaggtgccc
gccgcggagccggctgccgatagcgcaccccccgccatcgctcaggaagcgacgatctcg
gcggagacaagtgaattggccaaggccgcggccgccatgaaccaggaagccattgccgag
gcgctcaatgccgatgtgccgccgcgtgatgcggccgagcgggtggcgttcgcgacgtgg
gccatcgtcaccggcgagtcgccgggcagcatcttcaacgcactgcccaagatcgacgat
gcgacggccgagaagttggccgaacgtctgtcgcagcgcgctgacggcgaaattccggcc
gaggaggtcaagctcgcgccgaccatcgaagcccttggcgaggtagtccgcagcaggctc
gaagcaggcaagatcgacggctttgtgcggaccctggcaccccgccaggaaggctccacg
gcggttcccgtattcgtgttccatcccgccggtggctcgaccgtcgtctacgaaccattg
ctgaagcgtctgcccgagggcacgccgatgttcggcttcgagcgggtcgagggcaccatc
gaggagcgggccgccaagtacgtacccaagctgatggaactgcacgacggcccgttcatc
ctggccgggtggtctctcggtgcagtgctggcgtacgcctgtgcggtcggcctcaaggag
gccggcgccgaggtcgcatgggtcggcaacatcgacggtgtacgccccgggactccgatc
ttgcagaccaaggaagagacccggaaacgctgggaccgttatgcggcattcgcccagaag
acgttcaacgtcgagatcccggccatcccgtatgagcagctggaggagctcgacgacgcg
ggccaggtgacgttcgtgctggaggcggtcaaggccagcggtgtgcagattccgggcgga
atcatcgagcaccagcgcacgtcgtatctcgaccagcgggctattgacacgtccaccccg
gtgaagttcgacgggcacatgacgctctacatggccgaccgctaccacgatgacgccatc
acgttcgagcccgcgtacgcgacccgccagcccgacggcggttggggtgagttcgtctcc
gacctcgaggtcgttccggtcggcggtgagcacatccaggtcatcgacgaaccgatcatc
gctaaggtcggtgctcatatgagtcaggcgctgcggaccatcaacgcccaacaggcccag
caggcttag

DBGET integrated database retrieval system