KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0187Help
Entry
MAB_0187          CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_16 AAA_22 ATPase_2 DUF2791 AAA AAA_14 AAA_30 AAA_5 NTPase_1 TniB Clusterin
Motif
Other DBs
NCBI-GeneID: 5962730
NCBI-ProteinID: YP_001700941
UniProt: A0A2C9Y8T6
Position
193996..195162
Genome map
AA seq 388 aa AA seqDB search
MQPSPYTPGQVAREVVGRAEQLAEIGERLMYMTELGRLIGRIRVDTGPRGVGKTSLLREV
QRAAEARGVVTVWVTAGGEEPLTAAIATQIRARTAGWKKKSRGRLLRAIDQVSITAGVPG
VAQLGATVKPAQSAEGASPEPSFKELIVETVKAARDEGHRGLVLLIDEVQDADRQGLRTL
AVTWQDLQAEADALPAGLFAAGLPQTPEIISAAATFSERFAYRTLHRLGPDASRVALVKP
AGQVGVDWAPDALEAVIAQTNGYPHTLQLYADAAWARAGYPDPGGQIGMPDVEHAARQVA
EDMDALFRARWNNATPVQRRFMTAMAQSLTDDRVSSRSDIAAALGRDSRAISAARAGLID
KGLIAVAGHGLLEFSIPGFAEFVHAQEG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccagtccgtacacgccaggccaggtggcacgtgaggtcgtcggccgcgccgag
cagctggccgagatcggcgagcgactgatgtacatgacggagcttgggcggctgatcggc
cgcatccgtgtcgacaccgggccgcgtggtgtgggaaagacctcactgctgcgtgaggtc
cagcgtgcggccgaggcgcgcggtgtggtgacggtgtgggtgaccgcaggcggcgaggag
ccgctgacggcggcgatcgccacccagatccgcgcccgcaccgcggggtggaagaagaag
tcacgcggccggttactgcgagccatcgatcaggtgagcatcaccgccggtgtgccgggg
gtggcgcaactcggtgcgacggtcaaaccggcgcagtccgccgagggggcgtcaccggag
ccatccttcaaggaactgatcgtcgagacggtcaaggcggcgcgcgacgagggacaccgg
ggtctggtgctgttgatcgacgaggtgcaggacgctgaccggcagggattgcgcaccctg
gccgtcacctggcaggacctgcaggccgaggccgacgccctgcctgccgggttgttcgcg
gcgggcctcccgcagacgccggagatcatcagcgccgcagccaccttcagcgagcggttc
gcataccgcacattgcatcggctaggccccgacgcatcgcgggtggcgctggtcaagccc
gccggccaggtcggggtggactgggcgccggacgcgctcgaggcagtcatcgcgcagacg
aacggatatccgcacacgctgcagctctacgcggacgccgcgtgggcacgcgccgggtat
ccggatccgggaggccagatcgggatgcccgatgtcgagcacgccgcccgacaggtcgcc
gaggatatggacgcactctttcgcgcgcgctggaacaacgcgaccccggtgcagcggcgc
ttcatgacggcgatggcgcagtcattgaccgacgatcgggtgtccagccggtccgatatc
gcggccgcgttgggccgtgattcgcgggctatcagcgccgcccgcgccgggctcatcgac
aaggggctcatcgccgtggccggccacgggctgctggagttcagcatccccggtttcgcg
gagttcgtgcacgcgcaggagggctag

DBGET integrated database retrieval system