KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0190cHelp
Entry
MAB_0190c         CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
  KO
K13686  galactan 5-O-arabinofuranosyltransferase [EC:2.4.2.46]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
Enzymes [BR:mab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.46  galactan 5-O-arabinofuranosyltransferase
     MAB_0190c
Glycosyltransferases [BR:mab01003]
 Polysaccharide
  Bacterial polysaccharide
   MAB_0190c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AftA_N AftA_C
Motif
Other DBs
NCBI-GeneID: 5962733
NCBI-ProteinID: YP_001700944
UniProt: A0A0U0XM12
Position
complement(198847..200739)
Genome map
AA seq 630 aa AA seqDB search
MTAQTAEAARRHVLDTTKDLTLAVVTAAAVSVVALTAIARVEWPAFGSSNQLHALTTVGQ
FGAIAGLVLAGVLWRRGHRAVSKWLSLLFLATFTVVTVGMPLGATKLYLFGISVDQQFRT
EYLTRFTDSPALHDMTYPDMPPFYPAGWFWIGGRLAALTGTSGWEMYKPWAITSLAIAVC
AAFILWNRMIRFEYALIVSTATAAVTLAYASTEPYGAIVTVLLPPVLVLGYSALRADRGA
GWGAVVGTGVFLGFAALFYTLLTAFGALAITVAAAVVAMGRVRQNGWWPGVKEPLLRWLA
IAAISIVIALVFWGPYLVAVAHASLEKAASAQHYLPNEGAELSFPMLQPTMLGGLCLIGT
VWLVARARSSVRAGALAIGVTSVYLWSLLSMLATLAKTTLLSFRLVPTLTVLLAAAGVFA
FLELTAVAAKRTKHATLVATAIGLAGALAFSQDIPDVLRSDIVIAYADTDGTGQRADRRP
PGPESHYIAIDKAITEITGKPRDETVVLTADYSFLAFYPYYGFQGLTPHYANPLAQFDKR
AAAIKSWEDLHTADEMVRALDALPWRAPTVLLMRQSGDNYSLRLAKDVYPNQPNVKRYTV
TLNKQLFADPRFTVRTIGPFVLVVRVPPHA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccagacagcagaggcggcacgtcggcacgtactggacaccaccaaggacctg
acgctcgctgtcgtcacagccgccgccgtcagcgtggtcgcactcaccgcgatcgcgcgc
gtcgagtggccggccttcggctcgtccaaccagctgcacgcactcaccacggtcggacag
ttcggcgccatcgccggattggtgctggccggggtgctctggcgccgagggcaccgggcc
gtctcgaagtggctatcgctgctcttcctggccacgttcaccgtggtcaccgtcgggatg
ccgctgggcgccaccaagctgtacctgttcgggatctcggtggatcagcagttccgtacc
gagtacctgacccgcttcaccgattcgcccgcactgcacgatatgacctacccggatatg
cccccgttctacccggcgggctggttctggatcggtgggcgtctcgcggcgctcaccgga
acctccggttgggagatgtacaagccgtgggccatcacctctctggcaatcgcggtttgc
gcggcattcatcttgtggaacaggatgattcgtttcgaatacgcactcatcgtgagcact
gcgaccgccgccgtcaccctggcgtatgcctccaccgagccctatggcgcgatcgtcacg
gtgttgcttccacccgtgctggtgttggggtacagcgcactgcgcgcggatcgcggcgcg
ggctggggggccgtcgtggggacgggcgtgttcctgggcttcgcggcactgttctacaca
ctgctcaccgcgttcggcgcgctcgccatcaccgtcgccgccgcagtggtcgcgatgggc
cgcgtccggcagaacggttggtggccgggcgtcaaagagcccctgttgcgctggctcgcc
atcgccgcaatctctattgtcatcgccctggtcttctggggcccgtatctcgtcgccgtc
gcccacgcttctctggagaaggcggcctcggcacagcactatctgcccaacgagggtgcc
gagctgtccttcccgatgctgcaacccaccatgctgggcggtctgtgtttgatcggcacc
gtgtggctggtggcacgtgcgcgtagctcggtgcgtgccggggcgctcgccatcggtgtg
acgtccgtgtatctgtggtcgttgctgtccatgctcgccaccctcgccaagaccaccctg
ctgtcgttccggctggtgcccaccctcaccgtgctgctcgcggccgcgggtgtgttcgcc
ttcctggagctcactgcggtagcggcaaaacgcaccaaacacgccacactggtggccacg
gccatcggcctggccggggccctggccttcagccaggacatccccgacgtgctgcgctcc
gacatcgtcatcgcctacgccgataccgacggcaccggacaacgcgccgatcgccggccg
cccggcccggaaagccactacatcgccatcgacaaggcgatcaccgagatcaccggaaag
ccccgcgatgagactgtcgtgctgaccgccgactacagcttcctggcgttctatccctat
tacggcttccagggactcaccccgcactatgcgaacccgctggcacagttcgacaagcgc
gcggccgcgatcaagagctgggaagacctgcataccgccgacgagatggtgcgtgcgctc
gacgccctgccgtggcgggcccctaccgtgctgctgatgcgccagtccggcgacaactac
tcgctgcggctcgccaaggacgtctaccccaaccagccgaacgtgaagcggtacaccgtc
acgctgaacaagcagttgttcgccgatccccggttcaccgtccgcaccatcggtccgttc
gtgctcgtggtgcgggtgccgccgcacgcttag

DBGET integrated database retrieval system