KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0191cHelp
Entry
MAB_0191c         CDS       T00657                                 

Definition
(RefSeq) Putative short chain dehydrogenase/reductase
  KO
K16652  decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase [EC:1.1.1.333]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
KEGG Orthology (KO) [BR:mab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MAB_0191c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.333  decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase
     MAB_0191c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 B12-binding
Motif
Other DBs
NCBI-GeneID: 5962734
NCBI-ProteinID: YP_001700945
UniProt: A0A0U0XMM0
Position
complement(200747..201526)
Genome map
AA seq 259 aa AA seqDB search
MIDATGNPQTILLFGGTSEIGLAIVERYLKNAKARVILADLPNAPKREAAIEQIRAAGAK
EVQYVEFDALDTKSHPALIESAWAQGDVDVAIVAFGILGDAEELWQDQTKAVLSAQVNYT
AAVSVGVLIGQKMKAQGFGQVIAMSSVAGERVRRSNFVYGSTKAGLDGFYLGLGEALREF
GVRVLVVRPGQVRTTTTIEHWKATGAKEAPFTVDKEEIAELVVASAAAGKELIWAPGQWR
FVMSVLRHVPRPLFRKLPV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgccacgggcaacccccagaccatcctgctattcggcggcacctcggagatc
ggcctcgccatcgtcgagcgctacctcaagaacgccaaggcgcgcgtcatcctggccgac
ctgccgaatgcccccaagcgtgaggccgccatcgagcagatcagggccgcgggcgccaag
gaggtccagtacgtagagtttgacgccctggataccaagtcccaccccgcgctgatcgaa
tccgcctgggcacaaggcgatgtggatgtggccattgtcgccttcggcattctcggcgat
gccgaagaactatggcaggaccagaccaaggcggtgctgagcgcgcaggtgaactacacc
gccgccgtctccgtcggcgtgctgatcggccagaagatgaaggctcagggcttcgggcag
gtcatcgcgatgtcctcggtcgccggcgagcgggtacgccgctccaacttcgtctacggc
tccaccaaggccggcctggacgggttctacctcggcctcggagaagccctgcgcgagttc
ggtgttcgcgtgctggtggtccggcccggccaggtgcgcaccaccacgacaatcgagcac
tggaaggccaccggcgccaaggaggcaccgttcacggtcgacaaggaagagatcgccgag
ctggtggtggcatcggccgccgccggcaaggaactgatctgggcaccgggtcagtggcgc
ttcgtgatgtctgtgctgcgccacgtccctcgccccctcttccgcaagctgcccgtctag

DBGET integrated database retrieval system