KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0194Help
Entry
MAB_0194          CDS       T00657                                 

Definition
(RefSeq) Dihydroxyacetone kinase family protein
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00051  Fructose and mannose metabolism
mab00561  Glycerolipid metabolism
mab00680  Methane metabolism
mab01100  Metabolic pathways
mab01120  Microbial metabolism in diverse environments
mab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MAB_0194
  09102 Energy metabolism
   00680 Methane metabolism
    MAB_0194
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    MAB_0194
Enzymes [BR:mab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     MAB_0194
    2.7.1.29  glycerone kinase
     MAB_0194
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     MAB_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-GeneID: 5962737
NCBI-ProteinID: YP_001700948
UniProt: A0A2C9YB08
Position
203672..205336
Genome map
AA seq 554 aa AA seqDB search
MVPLRNFLNTTESFIPDALRGLVAATADLWWDREHGYLIRDSPLRPGQVAIVSGGGSGHE
PLHAGFIGRGMLTAACPGLIFTSPNALQIAGATVAADAGGGVLHVVKNYTGDVMNFSIAR
QIAGESSVRTEVVLVDDDVATEVADAAKPGRRGTAATVVVEKLCGAAAERGDQLAAVAAL
GRRVAASARSMAVALSPCTVPGAPVPSFDLPTGEMEIGVGIHGERGVDRAPVAPAAEIVA
ALLARILPAAQVRSGDEVIVVVNGLGATHSLELNLLFGEVAAQLAAAGIAVGRSLVGSFV
TALDMAGASITVVRADPEMFELWDAPTSAPGWPAVTGPPVGRLIDGTIVEPTDRADRGGE
NRWLSAFVERVRASVGMLTDLDRRAGDGDFGTNMAAALRHYELPLRGTDADVLLALSTSY
FVRAGGTSGAVFGTFFRALYGGLGSEPWSTERVAHAVRHGLDRIQALGGARVGDKTVVDA
VSPAADALDAAVRQGIPLALALRSAADAAAAGVQATRDAIAARGRASYVGEAARGVEDPG
ALVMSWFFEAAAGR
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggtcccgttgcggaacttcctgaacaccacggaaagcttcatccccgacgcgctgcgg
ggactggtcgcggccaccgccgacctgtggtgggatcgtgagcacggatatctgatccgg
gattcgccattgcggcccggccaggtggccatcgtgtcgggcggcggctcggggcacgag
cccctgcacgccggattcatcggtcggggcatgctgaccgccgcatgtcccggactgatt
ttcacctcgccgaacgccttgcagatcgcaggcgccactgtcgcggccgatgccggtggt
ggcgtgctgcacgtggtgaagaactacaccggtgacgtgatgaacttctccatcgcgcgc
cagatcgccggcgaatcctcggtgcgtaccgaggtggtgttggtcgatgacgacgtggcc
accgaggtggcggacgccgccaaaccgggccgccgtggcacggccgccaccgtggtggtc
gaaaagctgtgtggcgccgccgccgaacgtggtgaccagctggccgcggtggccgcgctg
ggacgtcgggtcgcggcgtccgcacgcagcatggcggtcgcgctgtcgccgtgcacggtc
cccggtgcgccggtgccgtcattcgatctgcccacgggcgagatggaaattggggtcggg
atccacggcgagcgcggtgtcgatcgtgcgccggtcgcccccgccgcagagatcgtggcc
gcgctgctggctcgcatcctgccggcggcgcaggtgcggtccggggatgaggtgatcgtt
gtcgtcaacgggctcggggccacccactcgctggagctcaatctcctcttcggcgaggtg
gccgcgcagctggcggccgcaggaatcgccgtgggccgcagccttgtcggcagcttcgtg
accgcgctggacatggcgggtgcttcgatcaccgtggtgcgcgcagacccggagatgttc
gagctgtgggacgcgcccaccagcgccccgggctggccggcggtgacgggtccgcccgtc
ggcaggctcatcgacgggacaatcgtcgagcccacggacagggccgaccgcggtggggaa
aatcgttggctctccgcgtttgtggagcgcgtgcgggcatccgtgggcatgctcaccgac
ttggaccggcgcgccggagacggtgatttcgggacgaatatggccgccgcgctgcggcac
tacgagctgccgctgcgcggaaccgatgccgatgtgctgcttgccctgtcgacctcgtat
ttcgtgcgcgcgggcggcacctccggtgcggtattcggcaccttcttccgtgcgttgtac
ggcgggctcggcagcgagccctggtctaccgagcgggtggcccatgccgtgcggcacggt
ctggatcggatccaggcgctgggcggcgctcgggtcggcgacaagaccgtggtcgacgcc
gtgtcgccggccgcggacgccctcgatgccgctgtgcgacagggcatcccactggccctg
gccctgcggtccgccgccgatgcggccgcggcgggtgtccaggccaccagggatgcgata
gccgcgcgcggccgggccagctacgtgggtgaggcggcccgcggcgtcgaagatcccggt
gccctggtcatgtcgtggttcttcgaggcggccgccggccgctga

DBGET integrated database retrieval system