KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0199Help
Entry
MAB_0199          CDS       T00657                                 

Definition
(RefSeq) Probable phosphoesterase, PA-phosphatase related protein
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MAB_0199
Enzymes [BR:mab01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     MAB_0199
Peptidoglycan biosynthesis and degradation proteins [BR:mab01011]
 Precursor biosynthesis
  Diphosphatase
   MAB_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAGK_cat PAP2 PAP2_3 NAD_kinase DUF212
Motif
Other DBs
NCBI-GeneID: 5962742
NCBI-ProteinID: YP_001700953
UniProt: A0A2C9YBN5
Position
208913..210406
Genome map
AA seq 497 aa AA seqDB search
MGLLPSRNSLKGLRQIGDGLGTLDREVFEAVAESPSPLLDAVMPRLTRAADHSKLWIGIG
VGLALFGKPAAARGATRGLLTLAVTSAVTNQVAKRLRRRERPNHLSVPLTRRSRRVPTSS
SLPSGHSASAAAFAVGVGLESPPLGFGLSLLAGLVGLSRVATGVHYPGDVFAGFGIGAGL
AVLGARVVPPIVTTSVPTGEPLRVETPARPGGEGVVLVVNPASGDGTGQRILEQVRKALP
RTEIVELSKDDDVIEVMRAAAGRAEVLAVGGGDGTVACAAGVAVETDRPLAVFPGGTFNH
FAKDIGCESVAKTVDAIRRGSVSRVDLVYLNERQVVINTASIGSYPKFVQVREKLERRIG
KPLAAVYAMLYVLRRDHPVRIRFDNKTIQTSLFFLGNSVYLPAGFAPSLRSRLDDGLIDV
RILETGRRFSGVRILTALALGRLQRSPLYHELQVPEFTFTAVDGPTVLARDGEAGDRYTE
AHFTVRYRALAVFRPLP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgttgccgtcacggaattctttgaagggtctgcgccagataggtgacgggctg
ggcacgctagatcgggaagtcttcgaagccgtcgcggagtcaccgagcccgttgcttgac
gccgtcatgccgcgcctcacccgcgccgccgaccactccaagctgtggatcggaatcggc
gtcgggctggcactgttcggcaagcctgccgctgcccgtggtgccacccgtgggctgctc
acgttggcggtgaccagcgccgtcaccaaccaggtggccaagcggctacggcggcgcgag
cggccgaaccacctctcggtgccgctgacgcggcgcagccggcgggtgccgacgtcgtcg
tcattgccctcagggcattcggcgagtgccgcggcgttcgcggtgggagtcggcctggaa
agcccgccgctgggctttgggctctcgctgctcgccggtttggtggggctgtcccgggtg
gcgaccggcgtccactaccccggcgacgtcttcgcgggatttgggatcggtgcgggactg
gcagtcctgggcgcgcgcgtggtgccgccgatcgtgacgacgtctgttccgacgggcgag
ccgctgcgggtggaaacacccgcacggcccgggggcgagggtgtcgtattggtggtcaat
ccggcgtccggcgatggcaccgggcagcggatcctggaacaggtgcgcaaagcgctgccg
cgcaccgaaattgtcgagctgagcaaggacgatgacgtcatcgaagtgatgcgtgcggcc
gcgggccgggcggaggtgctcgcggtgggaggcggcgacggcacggtggcatgcgctgcc
ggtgtggcggtcgagaccgacaggccgctggcggttttccccggcggcaccttcaatcac
ttcgccaaggacatcggctgcgagagcgtggccaagaccgtcgacgcgatccgacggggc
agtgtcagccgagtcgacctggtctacctgaacgagcgccaggtggtgatcaatacggcg
agcatcggttcctaccccaagttcgtgcaggtccgcgagaagctcgagcgccgcataggc
aaaccgctggccgccgtgtacgcgatgctgtacgtgttgcggcgcgatcacccggtgcgt
atccggttcgacaacaagacgattcagacctcactgttctttctgggtaattcggtctat
ctcccggcgggtttcgcgccgtccctgcgcagccggctggacgatggcctgatcgatgtg
cggatcctggaaaccggtcgccggttcagcggtgtgcggatcctgactgcgctggcactg
ggacgcttgcaacgcagcccgctctaccacgagctgcaggtgcccgaattcacgttcacc
gcggtggatggccctaccgtgctcgcccgcgatggggaagcgggcgacaggtacaccgag
gcgcacttcacggtgcgttaccgggcgctggcggtgttccgtccgctgccgtga

DBGET integrated database retrieval system