KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0201cHelp
Entry
MAB_0201c         CDS       T00657                                 

Definition
(RefSeq) Probable O-antigen/lipopolysaccharide transport integral membrane protein ABC transporter RfbD
  KO
K01992  ABC-2 type transport system permease protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
Module
mab_M00254  ABC-2 type transport system
Brite
Transporters [BR:mab02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    MAB_0201c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane
Motif
Other DBs
NCBI-GeneID: 5962744
NCBI-ProteinID: YP_001700955
UniProt: A0A2C9Y8N9
Position
complement(211043..211930)
Genome map
AA seq 295 aa AA seqDB search
MSSSAGLTSQRPGSKENDMANELIELSSDSRTFKRAWRDLSEGFEHRQLWLQLGWQDIKQ
RYRRSVLGPFWITIATGSTALAMGILYSQLFKLPLAEHLPYVTIGLIVWNLFNAAILEGS
DVFVANEGLIKQLPTPLSVHVYRLVWRQLLLFAHNIIIFLIVVAVYTPHWHFTDLSFIPA
LVLITLNCLWVSLVFGVLATRYRDISPLLGSLVQLLFFMTPIIWNENMLNQRVGKLATVV
QLNPFVHFLAIIRDPLLGLDQQLHHWIIALSITVVGWIVAIVVMRQYRARVPYWV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagttcggccggcctgacaagccagcgcccagggtcgaaggagaatgacatggcg
aacgaactgatcgaactatcatcggactcccgtaccttcaagcgcgcatggcgtgacctg
tcagagggtttcgagcatcggcagctctggttacagctcggctggcaggacatcaagcag
cgctatcggcgttcggtgctgggaccgttctggatcaccatcgccaccggatcgacagcg
ctggccatgggcatcctgtactcgcaactgttcaagctgccgctggctgaacatctgcct
tacgtgacaatcggtttgatcgtctggaacctcttcaacgcggcgatcctcgagggttcg
gacgtcttcgtcgcgaatgagggcctgatcaaacagctcccgactcctctgagtgtgcac
gtctatcggctggtctggcgacagctgctgctgttcgcgcacaacatcatcattttcctg
atcgtggtcgcggtatacacgccgcattggcatttcaccgatctcagtttcatccccgcg
ctggtgttgatcacgctgaattgcctgtgggtttccctggttttcggcgtgctggccacc
cgctatcgggatatctcaccgctgttgggcagcctggtgcaactgctgttcttcatgacg
ccgatcatctggaacgagaacatgctcaaccagcgggtgggcaagttggccaccgtggtg
cagctcaacccgtttgtgcacttccttgccatcatccgtgacccgctgctggggcttgat
cagcagctgcaccactggatcatcgcgctgtcgatcacggtggtcggttggatcgttgcg
atcgtggtgatgcgccagtatcgggccagggtcccgtattgggtttag

DBGET integrated database retrieval system