KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0214cHelp
Entry
MAB_0214c         CDS       T00657                                 

Definition
(RefSeq) Conserved hypothetical protein (OsmC-like)
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-GeneID: 5962757
NCBI-ProteinID: YP_001700968
Position
complement(225938..226459)
Genome map
AA seq 173 aa AA seqDB search
MTASTTSLNAITDATREAVADKPAAAHVVFTASAQPEGAVGSEISLGKYRVHVDEPPSLG
GQNTAPNPVEYYLASLLSCQVVTYRFWAERLGIQVDSLSASAEGDLDVRGFFGLDDSVRP
GFQQIRVTVTVAGPDTDARYRELQEAVDAHCPVLDLTTGTTPVHTTLITQGRP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcgtcgacaacctccctcaatgccatcaccgatgccacccgcgaggccgtggcc
gacaaacccgccgcggcgcacgtggtgttcacggcatcggcccagccggagggcgctgtc
ggcagcgagatcagcctgggcaagtaccgcgtacacgttgatgaaccgccaagcctcggt
gggcagaacacggcacccaaccccgtcgagtattacctcgcctcattgctgtcctgccaa
gtggtcacctaccgtttctgggccgaaaggcttggcattcaggttgattcactcagcgcc
agcgcggagggcgatctcgatgtgcgtggcttcttcggcctggacgacagcgtccggccc
ggctttcagcagatcagggtgacggtgacggtcgccggtcccgacaccgatgcgcggtac
cgggaactacaggaagccgtcgatgcccactgccccgtactagatctgaccaccgggacg
acaccggtacacaccacactgattacccaggggcggccgtag

DBGET integrated database retrieval system