KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0215Help
Entry
MAB_0215          CDS       T00657                                 

Definition
(RefSeq) Possible transcriptional regulator
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_12 HTH_IclR HTH_20 FaeA HTH_24 HTH_11 MarR_2 HTH_5 LexA_DNA_bind HTH_Crp_2 GerE GntR TrmB HTH_28 HTH_AsnC-type MarR
Motif
Other DBs
NCBI-GeneID: 5962758
NCBI-ProteinID: YP_001700969
UniProt: A0A2C9Y8R4
Position
226667..227335
Genome map
AA seq 222 aa AA seqDB search
MTGSRGAGQQRARVLKVLQEAAAPVGAREVADSLGLHITTVRFHLKTLEEQGHIVRRGGT
GEQRAGRPSLSYAVAPRLDYADVVALFAVHLGGTAAERESRAALVGADLAHRVNVARRRT
PLQVTDLVVETLGELGFTVRSTLMSFGRVTVQICSCPLAEIATTAPEVVRGIQRGLIQEV
LDVNADAIGGQFQVTVSPDAGHGDCTVNLALVPLGKESWPWT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcagtcgtggggcaggtcaacagcgggcgcgcgtcctgaaggtgctgcaagag
gcagcggcgccagtgggcgcacgggaagtggccgacagcttggggttgcacatcaccacg
gtgcggtttcacctcaagaccctcgaagagcagggacatattgtccggcgtggtggcacc
ggcgagcagagggcgggaaggcccagtctgtcctacgcggtcgcgccccgcctcgactat
gccgatgtggtggcgttgttcgcggtacatctcggtggcacagccgccgagcgtgaatcg
cgcgccgcgttggtcggggccgacctagcgcaccgggtgaatgtggcgaggcgccggacg
ccgctgcaggtcaccgacttggtggtggaaacccttggagagctcggatttaccgtgcgc
tcgacgttgatgtcctttggacgggtcaccgtgcagatctgctcatgcccactggcggaa
atcgcaacgaccgccccagaagtggtccgcggtatccagcggggcctgatccaagaggtg
ctcgacgtcaacgccgacgcgatcggcggacagtttcaggtcaccgtgtcccccgatgcc
ggtcacggtgattgcacggtcaacctggcgttggtgccactgggaaaagagagttggccg
tggacgtga

DBGET integrated database retrieval system