KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0216Help
Entry
MAB_0216          CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_3
Motif
Other DBs
NCBI-GeneID: 5962759
NCBI-ProteinID: YP_001700970
UniProt: A0A2C9YBS2
Position
227341..227661
Genome map
AA seq 106 aa AA seqDB search
MTALANAQAATARNAPSGRAAHTVHGGSGHALRQVIMALAARHKLAEHENPGEATLLVLS
GLVELATSTARATLAAGEYVVFPQERHELTAIEDSVVLLTVVSRAG
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgacggccctggcaaatgcacaggccgcaacggcacgcaacgcgcccagtggccgggcc
gcacacaccgtgcacggcggcagcggtcatgcgctccggcaggtgatcatggcgcttgcc
gccaggcacaagctggccgaacatgaaaatcccggcgaggccacactattggtgctcagc
ggactggtcgagctggcgacgtcaaccgctagggccaccctcgcggcgggagagtatgtg
gtctttccgcaagagcgccacgaacttacagcgatcgaggattccgtggtactgctgacg
gtggtgagccgggcggggtga

DBGET integrated database retrieval system