KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0219Help
Entry
MAB_0219          CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TED
Motif
Other DBs
NCBI-GeneID: 5962762
NCBI-ProteinID: YP_001700973
UniProt: A0A2C9Y8S6
Position
230893..232164
Genome map
AA seq 423 aa AA seqDB search
MTTHSLLSLVEWPSARITGSRRRSNAEVLPRRLTRYRGGTYSSTVDEVVFTDGTSARTDL
IRLNPTITAYSLDIAGIAPNLPSGYAVADWLSVANLRARTRESQVAWILANSFPALSTAR
LSRRLRAAGYLGEANIKDHEAIAGTQAAIWFLTNGVELDTAARNVPTATRKSPSFIEFEF
PERPQLGGLTIRTGVGQQPADVRLHASVNGAVWREVSSSELSLSAGAAQYAKVLGVGATV
AETQYGAPDRGYRFYRLYVQGGTADVETVEFWLHDARNHRNADRVVQLYRYLLEQSLLAA
GQAEHAPTIDDSQAVMAAGLMGPFVVDSQRPVVLSLSEGAKAMDISGAELSGPVDPGTRF
YVRPAECVATVTVSVVDLAATARVLTGVADGPLTPLALVHPGAHDVVELTVEWAPAAELS
RVS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcattctttgctatcgctcgtcgaatggccgtcggcccgcatcacgggcagc
cgtcgccgctcgaacgccgaggtgttgccgcgccgtttgacgaggtaccgcggcggcacc
tattcgtccactgtggacgaggttgtgttcaccgacggaacttctgctcgcacagattta
attcgcctgaacccgacgatcaccgcgtactcgctcgatatcgccgggatcgcccccaac
ctgccgtccggctacgcggtggcggattggctgtcggtggccaacctgcgggcacgcacc
cgcgaatcgcaggtggcctggatcttggccaactcctttccggcgctctccacggcgcgg
ctgagccgccggctgcgcgcggccggatatctgggtgaggccaacatcaaggaccacgag
gcgatcgccggaacccaggcggccatctggttcctcaccaacggggtggagctggatacc
gcagcacgcaatgtgccgacggcaacgcgaaagtcgccgtcgttcatcgagtttgaattc
ccggagcggccacagttgggcggcttgacgatccgcaccggcgtggggcagcagccagcg
gatgtccggctgcacgcgtccgtgaacggtgccgtgtggcgtgaggtctcctcctcggag
ctgagcttgtcggctggtgccgcacagtacgccaaggtattgggtgtgggtgcgacggtc
gccgaaacccagtacggcgcaccggatcgcggctaccggttctatcgcctttacgtgcag
ggtggcactgccgacgttgagaccgtcgagttctggttgcatgacgcgcgcaaccaccgc
aacgccgaccgtgtcgttcagctgtaccggtacctgctggagcagtcgctactcgccgcc
ggtcaggcggaacacgcgcccaccatcgatgactcgcaggcggtgatggccgcgggcctg
atggggccgttcgtggtggactcgcagcgtcccgtggtgctttcgctctccgagggcgcc
aaggcgatggacatttccggggctgagctctccggtccggtggatccgggcacccgcttc
tatgtacgccccgcggagtgcgttgcgacggtgacggtctcggtggtcgatctggccgcg
acggctcgggtgctcaccggggtggctgacgggccgttgacccccttggcgctggtacat
cccggtgcacatgacgtcgtggaattgacggtcgaatgggccccggccgcggaactgtcg
cgggtgagctag

DBGET integrated database retrieval system