KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0229Help
Entry
MAB_0229          CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAF4 Nitroreductase K_channel_TID
Motif
Other DBs
NCBI-GeneID: 5962772
NCBI-ProteinID: YP_001700983
Position
237313..237867
Genome map
AA seq 184 aa AA seqDB search
MEEAGRMTDARFPDRWLTDRRLQRLSDGHFRAFITSLTWSVSNRTDGVIEPEDLALIPNF
AAGAVKAFIAAGLWSPKGKSWHITEFTVTQTTKEQLNAIEQQRANEREKKARQRAAKLDA
ATSTNADVPVPVPAPVPTPVPGDVPGDNPGKDRPGKDRPGHSPNVLPFPDDWHGTGDNPY
TEYK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaggcgggccggatgacagatgcaaggttcccggatcggtggctgacagaccga
cgtctccagcggttaagtgacggccacttccgggccttcatcacctcgctcacatggtcg
gtatccaaccgcacagacggggtgattgaacccgaagatctggcgctgattccgaacttc
gcagccggggcggtgaaggcgtttatcgcggctggactgtggtcgcccaagggaaagagc
tggcacatcacggagttcacggtgacccagacgaccaaagagcagctcaatgccatcgaa
cagcagcgggccaatgaacgggaaaagaaagcacggcagcgggcagccaagctggacgcg
gctaccagcactaatgccgatgtccccgtacctgtcccggcgcctgtccccacccctgtc
ccgggggacgtccccggggacaacccaggcaaggacaggccaggcaaggacaggccagga
cactcgcccaacgtccttcccttccctgacgactggcacggcaccggagataacccctac
accgaatacaagtag

DBGET integrated database retrieval system