KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0230Help
Entry
MAB_0230          CDS       T00657                                 

Definition
(RefSeq) Hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_5 HTH_40 HTH_23 HTH_20 HTH_28 Sigma70_r4_2 HTH_38 RexA SpoIIID
Motif
Other DBs
NCBI-GeneID: 5962773
NCBI-ProteinID: YP_001700984
Position
237901..238659
Genome map
AA seq 252 aa AA seqDB search
MSEVAVLEQGADVEVVVPMDRRSAERLDQRIRQVAGTVRDNFVKLAAFVEEAKAGNIHEV
LGFASWTAYLADALGGQLEVRGPVRLEVVQFLAGEGMSTRGIAAITGASKSTIANDLAQV
SNSGHVDSDGDQSAVPNGTPADEQKTVGLDGKEYRKPKPRKKPEPKPVEETAQTEDTPPA
RAVQIPTAIRQLTVKLKGATDELTALTYDKRWDKALGRLTDADAEALQTIAVTIADIHAG
IATALARTEEEV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtagcagtactagagcagggtgccgacgttgaggtcgtcgtacctatggac
cggcgttcagcagaacgactagatcagcgcatccgtcaggttgccgggacagtcagggac
aacttcgtgaagctggccgcgttcgtggaagaggctaaggctggaaatatccatgaggta
cttgggttcgccagttggacagcgtatctcgccgacgccctcggtggtcagctggaagtg
cgcgggccggtgcgtctggaggtcgtgcagttcctagccggtgaagggatgagtacacgc
ggtatagctgcgatcaccggggcgtcgaagtccactatcgcgaatgaccttgcgcaggtg
tccaattctggacacgtggattcggacggcgatcaatcagctgtcccaaatgggacacct
gccgatgagcagaagacggtcgggctagacggcaaggaataccggaagcccaagccgcgt
aagaagccagagcccaagccagtagaggagaccgcacaaaccgaggacactcccccggca
cgtgcagtccaaatacccaccgctatacggcagctcacggtgaagctcaagggcgcgacg
gacgaactcacggcactgacctacgacaagcgttgggacaaggcgttaggccgtctcacc
gatgcggacgccgaagcactgcagaccatcgcagtcaccatcgccgacatacacgcgggc
atcgcaaccgccctggcccggacagaggaggaggtgtga

DBGET integrated database retrieval system