KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0231Help
Entry
MAB_0231          CDS       T00657                                 

Definition
(RefSeq) hypothetical protein
Organism
mab  Mycobacteroides abscessus ATCC 19977
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5962774
NCBI-ProteinID: YP_001700985
Position
238662..239084
Genome map
AA seq 140 aa AA seqDB search
MGPQEDRLAAARDQAAQAKAQALQDQPWSTLCDVYASEGGVVAVPTPAASELMGRRMAFD
MLASSGTAEDVHRVFYEYVSIVGSPAYVLPVVTGALMVLAIEICQAMIGELENKSDPDQR
IHLADAARIAWSLRLEGGSI
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtggggccacaagaggatcggcttgcagctgcccgtgatcaggcagcgcaggcgaaagct
caagcgttgcaggatcagccgtggtccacgttgtgtgatgtctacgcgagtgaggggggt
gtggtggcagtgcccacccccgccgcgtcggagttgatgggtcggcggatggcgttcgac
atgctggcatcctcgggtaccgccgaggacgtgcaccgcgtgttctacgagtacgtctcg
attgtgggttcgcccgcgtatgtgctgccggtagtgaccggggcgctgatggtgctggcg
atagagatctgccaggccatgattggcgagctggagaacaagagcgaccccgaccagcgc
atccatctggccgacgccgcgcgcatcgcgtggtctctgcggcttgaggggggctccatt
tga

DBGET integrated database retrieval system