KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0320Help
Entry
MAB_0320          CDS       T00657                                 

Definition
(RefSeq) Recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAB_0320
DNA repair and recombination proteins [BR:mab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     MAB_0320
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MAB_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 IMS_HHH zinc_ribbon_2
Motif
Other DBs
NCBI-GeneID: 5962862
NCBI-ProteinID: YP_001701073
UniProt: F8SQ47
Position
321765..322373
Genome map
AA seq 202 aa AA seqDB search
MFEGPVQDLIDELGKLPGVGPKSAQRIAFHLLGVEAPDIDRLTAALTRVRDGVQFCEVCG
NVSDKERCRICADPRRDIALVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLTRIGTEEDGVSISEVIIATDPNTEGEATATYLVRMLRDFPGLTVTRLASGLPM
GGDLEFADELTLGRALSGRRPL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagggcccggtccaggacctcattgacgagctgggcaagctgcccggggtaggg
cccaagagcgcgcagcgcatcgcattccatttgttgggtgtcgaggcgcccgatatcgat
cgactgaccgctgcactgacgagggtgcgcgacggcgttcagttctgcgaggtgtgcggg
aacgtctccgataaggagcgttgccgcatttgcgctgatccgcgccgtgacatcgcgctg
gtctgcgttgtcgaggaacccaaggatgtgcaggcggtcgaacgcacccgtgaattccgg
ggccgctaccacgtgctcggcggcgcgctggatccgctctcgggagtcgggcccgatcag
cttcggattcgggaactgttgacccgcataggaaccgaggaggatggggtgtccatctcc
gaggtcatcatcgctaccgacccgaataccgagggcgaggccaccgcgacctacttggtg
cggatgctgcgcgacttccccgggctcaccgtcacccgattggcctccggcctaccgatg
ggcggagacctggaattcgccgatgagctgacgctcggacgtgccctctcgggtcgccgc
cccctctga

DBGET integrated database retrieval system