KEGG   Mycobacteroides abscessus ATCC 19977: MAB_0425cHelp
Entry
MAB_0425c         CDS       T00657                                 

Definition
(RefSeq) Acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00010  Glycolysis / Gluconeogenesis
mab00620  Pyruvate metabolism
mab00640  Propanoate metabolism
mab00680  Methane metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAB_0425c
   00620 Pyruvate metabolism
    MAB_0425c
   00640 Propanoate metabolism
    MAB_0425c
  Energy metabolism
   00680 Methane metabolism
    MAB_0425c
Enzymes [BR:mab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MAB_0425c
Lipid biosynthesis proteins [BR:mab01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MAB_0425c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 5962962
NCBI-ProteinID: YP_001701178
UniProt: A0A0U1BL87
Position
complement(423824..425800)
Genome map
AA seq 658 aa AA seqDB search
MTETSIEPDSYPPSPEFVATANATADLYQAAEEDRLGFWEQQAGRLHWDEPFGQVLDWSD
APFAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIHWEGEPGDTRTITYAELLAQVSQAANY
LTELGLVSGDRVAIYMPMLPEAIVAMLACARLGLMHSVVFAGFSAAALRARIDDAQAKLV
ITSDGQWRRGTAAPLKSQVDEALGAAGPATSDLGGEPSSVEHVLVVRRTEIPVEWTEGRD
LWWHETVDKADTTHTAEPFDSEHPLFLLYTSGTTGKPKGIVHTSGGFLTQTSYTHFNIFD
LKPETDVYWCTADIGWVTGHTYIVYGPLSNGATQVVYEGTPTSPNEHRHFEIIEKYGVTI
YYIAPTLVRTFMKWGREIPFAHDLSSLRLLGSVGEPINPEAWRWYREVIGGNRTPIVDTW
WQTETGSAMISPLPGVTETKPGSAMRAVPGISAKIVDDEGNQLEPASGDEPVTGYLVLDK
PWPSMLRGIWGDPERFKETYWSRYAEQGWYFAGDGARYDSDGAIWVLGRIDDVMNISGHR
ISTAEVESALVGHDGVAEAAVVGASDETTGQAIVAFVILKASHTVEGDELVSHLKAQVSK
EISPIAKPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPSVFEAIRASK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaccagcatcgagccggacagctatccgccgtcgccggaattcgtagcgaca
gcgaatgcgaccgccgacctctaccaggcggccgaggaagatcggctcgggttctgggag
caacaggccggccgcctgcactgggacgagcccttcgggcaggttctcgactggtccgac
gcgcccttcgcgaagtggtttgtgggcggcaagctcaacgtcgcgtacaactgcgtcgac
cggcatgtagaggccggcaacggcgatcgggtcgccatccactgggagggcgaaccgggc
gacacccgcaccatcacctatgccgagctgctggctcaggtcagtcaggccgccaactac
ctgaccgaactcggcctggtatccggtgaccgggtggccatttacatgccgatgctgccc
gaggccatcgtggcgatgctggcatgtgcgcggctgggtctgatgcacagcgtcgtcttt
gcgggattctccgcggcagcgctgcgcgcccgcatcgatgacgcacaggccaagctggtc
atcacctccgacggccaatggcgccgcggcaccgccgcccccttgaagagtcaggtagac
gaagccctgggagccgcggggccggcgacatcagacctgggcggtgagccgagctctgtc
gagcacgttctggtggtgcgccgcaccgagattccggtcgaatggaccgagggccgggac
ctgtggtggcacgagacggtcgacaaggctgacaccacccacactgctgaacctttcgat
tccgagcatccgctgttcctgctgtacacctccggaaccaccggtaagcccaagggcatc
gtgcacacctcgggcggcttcctgacgcagacgtcgtacacccacttcaacatcttcgac
ctcaagcccgagaccgatgtgtactggtgcacagccgatatcggctgggttaccggacac
acctacatcgtctacggcccgctctccaacggcgctacccaggtggtgtatgagggaacg
cccacctccccgaacgaacatcgtcacttcgagatcatcgaaaagtacggcgtcaccatc
tattacatcgcgcccaccctggtcaggacattcatgaaatggggccgcgagatcccattc
gcgcatgatctgtccagcctgcggctgctcggcagtgtcggcgagccgatcaaccccgag
gcctggcgctggtaccgcgaggtcatcggcggcaaccgcacaccgatcgtggacacctgg
tggcagacggagaccggctcggccatgatttctccgctgcccggcgtcaccgagaccaaa
cccggttccgcgatgcgcgcggtccccggcatttccgcgaaaatcgttgatgacgaagga
aatcagctggagcccgcgagcggcgatgaaccggtcaccgggtatttggtgctggacaag
ccgtggccgtcgatgctgcgcgggatctggggcgacccggagcggttcaaggagacgtac
tggtcccgctacgccgagcagggctggtacttcgccggcgacggcgcacgttacgacagc
gacggtgccatctgggtcctggggcgcatcgacgacgtcatgaacatctccgggcaccgg
atctccaccgccgaggtggagtccgcactggtcggacacgacggtgtcgccgaggcggcc
gtcgtcggcgcctccgacgaaacgaccggacaggcgatcgtggccttcgtgatcctgaag
gccagccacaccgtcgaaggcgacgaactcgtctcacacctgaaagctcaggtttccaaa
gagatttcgccgatcgccaagccgcgagagattcacgtggtgccggagctacccaagaca
cgcagcggcaagatcatgcggcggctgctgcgtgatgtggccgagggacgcgaactgggc
gacacctcaacgctggtggatccgagcgtcttcgaggcgatcagggccagtaagtag

DBGET integrated database retrieval system