KEGG   Mycobacteroides abscessus ATCC 19977: MAB_1056Help
Entry
MAB_1056          CDS       T00657                                 

Definition
(RefSeq) Succinyl-CoA synthetase, beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00020  Citrate cycle (TCA cycle)
mab00640  Propanoate metabolism
mab00660  C5-Branched dibasic acid metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
Module
mab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAB_1056
   00640 Propanoate metabolism
    MAB_1056
   00660 C5-Branched dibasic acid metabolism
    MAB_1056
Enzymes [BR:mab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MAB_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 5963584
NCBI-ProteinID: YP_001701800
UniProt: A0A0U1BTQ0
Position
1065715..1066884
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTTTAEDAKAIAEEIGKPVMIKAQVKVGGRGKAGGVK
YAATPDDALTHAQNILGLDIKGHIVKKILVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGVEIEVTAEENPDALAKVPVDAVKGVDLALAREIAEKGKLPAEVLDSAAVTIQKLWEVF
VGEDATLVEVNPLVRTPDNQILALDGKVTLDGNADFRQPGHAEFEDKDATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGENHNGVKPANFLDIGGGASAEVMAAGLD
VILGDSQVKSVFVNVFGGITACDAVANGIVGALKTLGNTASKPLVVRLDGNKVEEGRAIL
AEFNHPLVIQAETMDAGADKAAALAAASN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtaccaggccaaggagctgttcgctaagcacaatgtgccgacgacg
ccgggccgggttaccaccaccgccgaggatgccaaggcgatcgccgaagaaatcggcaag
ccggtgatgatcaaggctcaggtcaaggttggcggacgtggcaaggccggtggtgtgaag
tacgccgccacccccgatgacgctcttactcacgcacagaacattctgggcctggacatc
aagggccacatcgtcaagaagatcctcgtcgccgaggccagcgatatcgccgaggagtac
tacatctccttcctgctggaccgtgccaaccgcacctacctggccatgtgctcggtcgag
ggcggtgtcgagatcgaggtaaccgccgaggagaaccccgacgcactggccaaggtgccc
gttgacgccgtcaagggtgtcgacctggcgctggctcgtgagattgccgagaagggcaag
ttgcccgccgaggtactggactccgccgcggtgaccatccagaagctgtgggaggtcttc
gtcggcgaggatgccaccctggtggaggtcaacccgctggtgcgcacccccgacaatcag
atcctggcgctggacggcaaggtcaccctggacggcaacgccgatttccgtcagcccggc
catgccgagttcgaggacaaggacgccaccgatccgctggaactcaaggccaaggagcac
gacctcaactacgtcaagctcgatggtcaggtcggcatcatcggcaacggcgcaggtctg
gtcatgtccaccctggatgtcgtcgcgtatgcgggcgagaaccacaacggcgtgaagcct
gccaacttcctggatatcggtggtggcgcctcggccgaggtgatggctgccggtcttgat
gtcatcctgggtgactcgcaggtcaagagcgtttttgtgaacgtgttcggtggcatcacc
gcatgtgacgcggtggctaacggcatcgtcggcgccctgaagactctcggtaacacggcc
agcaagccgttggtggttcgtctcgacggcaacaaggtcgaagaaggacgggcgattctg
gccgagttcaatcatccgctggtgatccaggccgagaccatggacgccggtgccgacaag
gcggccgccctggcggccgcatccaactag

DBGET integrated database retrieval system