KEGG   Mycobacteroides abscessus ATCC 19977: MAB_1192cHelp
Entry
MAB_1192c         CDS       T00657                                 

Definition
(RefSeq) Probable acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00071  Fatty acid degradation
mab00072  Synthesis and degradation of ketone bodies
mab00280  Valine, leucine and isoleucine degradation
mab00310  Lysine degradation
mab00362  Benzoate degradation
mab00380  Tryptophan metabolism
mab00620  Pyruvate metabolism
mab00630  Glyoxylate and dicarboxylate metabolism
mab00640  Propanoate metabolism
mab00650  Butanoate metabolism
mab00900  Terpenoid backbone biosynthesis
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
mab01212  Fatty acid metabolism
mab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAB_1192c
   00630 Glyoxylate and dicarboxylate metabolism
    MAB_1192c
   00640 Propanoate metabolism
    MAB_1192c
   00650 Butanoate metabolism
    MAB_1192c
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MAB_1192c
   00072 Synthesis and degradation of ketone bodies
    MAB_1192c
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAB_1192c
   00310 Lysine degradation
    MAB_1192c
   00380 Tryptophan metabolism
    MAB_1192c
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAB_1192c
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAB_1192c
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MAB_1192c
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mab04147]
    MAB_1192c
Enzymes [BR:mab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAB_1192c
Exosome [BR:mab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAB_1192c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-GeneID: 5963716
NCBI-ProteinID: YP_001701934
UniProt: A0A0U1AS36
Position
complement(1206144..1207361)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAGKGSLVSMRPDDLAAQMVRAALDKVPALDPKDVDDLMLGCGQP
GGEAGFNIGRAVAVQLGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGHAFISAGVETV
SRFPKGTSDGWPDSHNPLYADAEARTATAAQGATEWHDPRNDGLTPDVYIAMGQTAENVA
LHTGISREDQDHWGVRSQNRAEKAIADGFFEREITPVTLADGTVVAKDDGPRAGTTYEAI
SQLKPVFRPNGTITAGNACPLNDGAAALVVMSDVRAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEAVKRALANAGKSIGDIDLFEINEAFAVQVLGSARALGIDEDKLNVSGGAIALGH
PFGMTGARITATLLNNLTTYDKTFGVETMCVGGGQGMAMVIERLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgtgatcgtttccactgcccgctccccgatcgggcgagccggcaagggc
tcgctggtgagcatgcggccggatgacctggccgcgcagatggtgcgcgccgccctcgac
aaggtgcccgcactggaccccaaggatgtcgacgacctgatgctgggctgcggtcagcca
ggcggcgaggccggtttcaacatcggtcgcgcggtggcggtacagctgggctacgacttc
ctgcccggcaccaccgtcaaccgttactgctcgtcgtcgctgcagaccacccgcatggcg
ttccacgccatcaaggccggcgagggtcacgcattcatttccgctggtgtggagacggtt
tcgcgctttccgaagggcacttcggacggatggccggacagccacaacccgctgtacgcc
gacgccgaggcccgcaccgcgaccgcggcacagggtgccaccgaatggcacgacccgcgc
aacgacggcctgacccccgacgtgtacatcgcgatgggccagaccgccgagaacgtggca
ctgcacaccggcatcagccgtgaggaccaggaccactggggcgtgcgcagccagaaccgg
gccgaaaaggccattgccgatggctttttcgagcgcgagatcaccccggtgacgctggcc
gacggtaccgtcgtggccaaggacgacggcccccgcgccggcaccacctacgaggccatc
agccagctgaagccggtgttccgccccaacggcaccatcactgccggtaacgcctgcccg
ctgaacgacggtgcggccgcgctggtcgtgatgagcgatgtgcgcgccaaggagctgggc
ctgaccccgctggcgcgcatcgtctctaccggtgtgtccggcctgtcgccggaaatcatg
ggcctgggcccgatcgaggccgtcaagcgcgcactggccaacgcgggcaagtcgattggc
gacatcgatctgttcgagatcaacgaggcgttcgccgtccaggtgctgggctcggcgcgc
gcgctcggcatcgatgaggacaagctgaacgtctccggcggtgcgatcgcgctgggtcac
cccttcggcatgaccggtgcccgcatcaccgccaccctgctgaacaacctgaccacctac
gacaagaccttcggtgtcgagaccatgtgtgtgggtggcggccagggtatggcgatggtc
atcgagcggctcgcctag

DBGET integrated database retrieval system