KEGG   Mycobacteroides abscessus ATCC 19977: MAB_1433Help
Entry
MAB_1433          CDS       T00657                                 

Definition
(RefSeq) Arginyl-tRNA synthetase (ArgS)
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MAB_1433
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mab01007]
    MAB_1433
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mab03016]
    MAB_1433
   03029 Mitochondrial biogenesis [BR:mab03029]
    MAB_1433
Enzymes [BR:mab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     MAB_1433
Amino acid related enzymes [BR:mab01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MAB_1433
Transfer RNA biogenesis [BR:mab03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MAB_1433
 Prokaryotic type
   Other AARSs
    MAB_1433
Mitochondrial biogenesis [BR:mab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MAB_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1 tRNA-synt_1g tRNA-synt_1f HIRAN
Motif
Other DBs
NCBI-GeneID: 5967478
NCBI-ProteinID: YP_001702173
UniProt: A0A418LDF7
Position
1436823..1438475
Genome map
AA seq 550 aa AA seqDB search
MTPADLADLLRSTATTVLDERGLDTSALPAVVTVERPRNPEHGDYATNVALQVAKKVGVA
PRDLAGWLVEALVSHAAIAGAEIAGPGFVNLRIAADAQGTIVANILKAGETYGNSDAQGT
HTINLEFVSANPTGPIHIGGTRWAAVGDALGRLLARQGAKVTREYYFNDHGAQIDRFVRS
LIASAEGKEAPEDGYAGDYIADIAKQVITQRPEALTLTEPERSEVFREIGVDLMFTHIKE
SLHEFGTDFDVFTHEDSMHTSGRVQEAIAQLRKTGNIYEKDGASWLRSSNFGDDKDRVVI
KSDGNPAYIAGDIAYYLDKRERGFDLCIYMLGADHHGYIARLKAVAAALGYDADSVEVLI
GQMVNLVRDGQPVRMSKRAGTVITLDDLVDAIGVDAARYALIRSSVDTSIDIDLELWASA
SSENPVYYVQYAHARLCALARNAADLGLQHSTEHLELLTHEKEGALIRGLGEFGRILQNA
AALREPHRVARYLEDIAGDYHRFYDSCRVLPQGDETPGDLHAARLALCLATRQVIANGLD
ILGVSAPERM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgactcccgccgacctcgccgacctgctgcgttccaccgctaccacggtgctggacgag
cgaggtctggacacgtcggcactgcccgccgtggtgacagtcgaacggccccgtaatccg
gagcacggagactacgccaccaacgtggccttacaggtcgccaaaaaggtgggcgtcgcg
ccgcgtgacctggccggctggctcgtcgaggccctcgtgtcccacgcggcgatcgccggg
gccgagatcgccgggcccgggttcgtgaacctgcggatcgcggccgacgcacagggcacc
atcgtggcgaacatcctgaaggcgggggagacctacgggaattccgacgcgcaaggcacg
cacaccatcaacctggagttcgtctccgccaacccgacgggcccgattcacatcggcggt
acccgatgggccgcggtgggcgatgcgctcggccgcctgttggctcgtcagggcgccaag
gtcacccgcgagtactacttcaacgaccacggcgcccagatcgaccggtttgtccggtcg
ctcatcgcgtcggccgaggggaaggaagccccggaagacgggtacgccggcgactacatc
gccgatatcgccaagcaggtcatcacccagcggcccgaggcgctcacgctgacggagccc
gagagatccgaggtcttccgagagattggcgtggacttgatgttcacccacatcaaggag
tcactgcacgagttcggcacggatttcgatgtcttcacccacgaggactcgatgcacacg
tcaggccgggtgcaggaggccatcgcccagctgcgcaagaccggaaacatctacgagaag
gacggcgcgtcctggctgcggtcgagcaacttcggtgacgacaaggatcgtgtcgtcatc
aagagcgacggcaaccccgcctacatcgccggtgatatcgcctattacctcgacaagcgc
gagcggggcttcgacctgtgcatctacatgctcggtgccgatcatcacgggtatatcgcg
cgcctgaaagccgttgccgccgcactgggttacgacgccgacagcgttgaggtgcttatc
ggtcagatggtcaacctggtgcgtgatggccagccggtgcgcatgtccaagcgcgcgggg
accgtcatcaccctcgacgacttggtagacgccatcggcgtggatgcggctcgctatgcg
ctgatccgttcctcggtggacacctcgatcgacattgatctggagctgtgggcgtccgcg
tcgagtgagaacccggtctactacgtccaatacgcgcacgcacggctctgtgcactggcc
cgcaacgcggccgatctgggtctgcagcactcgacggagcacctggagctgctcacccac
gagaaagaaggtgcgctcatccgtgggctcggcgagttcggccggatcctgcagaacgcc
gcagcgttgcgcgaaccacaccgtgtcgcaaggtatttggaagacatcgccggcgactac
caccggttctatgattcgtgccgggtgctcccgcaaggcgacgagacccccggcgacctc
cacgcggcccggctcgcactgtgcctggccactcgccaagtcatcgccaacggcctggac
atcctcggcgtgagcgcaccggagcggatgtga

DBGET integrated database retrieval system