KEGG   Mycobacteroides abscessus ATCC 19977: MAB_2681Help
Entry
MAB_2681          CDS       T00657                                 

Definition
(RefSeq) Probable malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00020  Citrate cycle (TCA cycle)
mab00620  Pyruvate metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
Module
mab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAB_2681
   00620 Pyruvate metabolism
    MAB_2681
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MAB_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-GeneID: 5965190
NCBI-ProteinID: YP_001703415
Position
2723624..2725120
Genome map
AA seq 498 aa AA seqDB search
MSRIPRASQAHPIDADVVLIGGGIMSATLGSMLSILAPEWRIVLLERSDALATESSGPWN
NAGTGHTGFCELNYMPDPGDGAQAAAIARQFHLSRQWWSYLADHALLRPDTFIHSAAHMD
VVFGHRDANYLRQRYETLAADPMFSGMRFSDDPATIERWAPLVMRGRTPGGPIAATLHPE
GTDVDFGALTAALTRIVTDRGGQLRLGHEVRALRQSIDGSWMVTGRNAEGGFAVRTHKVF
VGAGGHALRLLQRAHLAEVRGYAVLPVGAAFLRSANAAVADAHTTKVYGQAPVGAPPMSV
PHLDKRIVDGRPYVMFGPYATFSTKLLKHGRWTDFFSTVRWHNLHVIAAALLQNLALIRY
LIGQVVAGPRQRMGQLRRYYPTAAPDDWELVPAGQRAQLITPDPRQVGVLRHGTELVVSA
DHSIAGLLGASPGASTAVPIMLDALRRCFPEQWRTTWQRTLTAAMPGAGDITWDEAAVTR
SARSTARSLRLDQARPSN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatcccgcgagcatcccaagcgcaccccatagacgccgacgtcgtgctgatc
ggcggcggaatcatgtcggcgaccctgggctcgatgctgtcgatcctggcaccggagtgg
cgaattgtattgctggagaggtcagatgcgctcgccacggaaagtagcggcccctggaac
aatgccggcaccggccacaccggtttctgcgaactcaattacatgcccgatcccggcgac
ggcgcccaggccgccgcgatcgctcgccaattccacctcagccggcagtggtggtcgtat
ctggcggaccacgcattgctacgccccgacaccttcatccactctgccgcgcatatggac
gtggtcttcgggcaccgcgacgcgaactatctgcgccaacgctacgaaaccctggccgcg
gatccgatgttcagcggaatgcggttcagcgatgaccccgccaccatcgaacggtgggcg
cccttggtgatgcgcggtcgcacgcccggcggacccatcgctgccaccttgcacccggag
gggaccgatgtcgatttcggggctctcaccgcagcactgacacgtatcgtcaccgatcgc
ggtggccagctccggttggggcacgaggtccgcgcgctgcgccagagtatcgatggatcc
tggatggtgaccggccgaaacgccgagggcggcttcgcggtacgcactcacaaggtattc
gtgggcgcgggtgggcatgcgctacggctcctgcaacgcgcgcatctggccgaggtgcgc
ggatacgccgtgctacccgtgggcgccgcgttcctgcgctcggccaatgccgccgtggcc
gacgcgcacaccaccaaggtgtacgggcaagcccccgttggtgctcccccgatgtcagta
ccgcatctcgacaaacgcatcgtcgacggacggccgtacgtgatgttcgggccgtacgcg
acattcagcaccaagctgctcaaacacggacgatggaccgacttcttcagcaccgtgcgc
tggcacaacctgcatgtgatcgctgccgcactactccagaacctcgccctcatccgatat
ctgatcgggcaggtcgtcgccggcccgcgtcagcggatggggcagctgcggcgctactac
cccaccgccgcgccagacgattgggaacttgtgccggcgggacaacgcgcacaactgatc
acgcccgatccccggcaggttggtgtgcttcggcacggcaccgaactggttgtcagcgcc
gatcacagcatcgccgggctactcggcgcctcccccggggcatccaccgcggtgccgatc
atgctcgacgcactgcgacgctgcttccccgagcaatggcggaccacctggcaacggacg
ctgaccgcggccatgccgggtgccggagacatcacctgggacgaggcggcggtcacccgt
tcggcgcggagtactgcacgttcactgcggctcgatcaagctaggccgtcgaattag

DBGET integrated database retrieval system