KEGG   Mycobacteroides abscessus ATCC 19977: MAB_2985cHelp
Entry
MAB_2985c         CDS       T00657                                 

Definition
(RefSeq) Protoporphyrinogen oxidase HemY'
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00860  Porphyrin and chlorophyll metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAB_2985c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MAB_2985c
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     MAB_2985c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 Trp_halogenase Thi4
Motif
Other DBs
NCBI-GeneID: 5965492
NCBI-ProteinID: YP_001703717
UniProt: A0A2C9Y490
Position
complement(3045028..3046404)
Genome map
AA seq 458 aa AA seqDB search
MTPQPSGSPSIAIVGGGISGLTAAYRLRRELGDDARISLYDPAGQLGGILRTITLGEHRI
DIGAEAFITRRPEVLDLLDELGLADRTLDTTGARPLIYAGGGLHPLPARTVNGIPASASS
VVGLVDEETVARIDSEPQRDMHWTVGAEPTVADLVALRFGPQVVARLVDPLLGGVYAGSA
ATTGLRTAAPGIARALDEGAGSLLAAARQALPPISDSGIFGAVDGGYAVLVEELWSRARA
EHVQVAVTGIERDGAGWAVTGEGGLTDAVDAVIVAVPAPRAAAILEAVAPESAAAARTIP
VASSVVVALTLPGDAPIPANSGVLVASGEALHTKAITFSTSKWGLRGRSTQVVRLSYGRF
GDTVARATTDEQLRHWAVADLEAVLGAGIVPVNSAVARWIDAMPQYGPGHAEVVDAIRSG
LPSGIAVAGSYLDGIGVPACVASASQAAQASVARWRHG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgcagccgtcgggttctccctccattgccattgtggggggcggtatttcgggc
ctgacggcggcatatcggctccgccgcgaacttggtgatgacgcccgcatcagcctctac
gacccggccgggcagttgggcggcatcctgcgcaccatcaccctgggtgaacaccggatc
gacatcggcgccgaggccttcatcacccggcgcccggaggttctcgacctgctggatgaa
ctggggctggccgaccgcacgctcgacaccaccggcgcgcggccgctgatctacgccggc
ggcggcttgcatccgctgcccgcgaggacggtgaacggcattccggcttcggcgtcgtcg
gtggtggggctcgtcgacgaggaaaccgttgcccgcatcgacagtgaaccccagcgcgac
atgcattggaccgtcggagccgaaccgaccgtcgctgaccttgtcgccctgcgattcggg
ccgcaggtcgtcgcccggctggtcgatccgttgctcggtggcgtgtatgcgggctcggcc
gcgacgacgggtctgcgtacggcagcccccggcattgcccgggcactcgacgagggagcg
ggcagtctgttggccgcggcccggcaggcgttgccaccgatctccgacagcggcattttc
ggtgctgttgacggcggctatgcagtgctggtggaggagctctggagccgtgcgcgggcc
gaacatgtgcaggtcgcggtgaccggcatcgaacgtgacggcgcgggctgggcggtcact
ggcgagggcggactgacggacgccgtcgatgccgtcatcgtggcggtgccggcaccccgc
gcggccgcaattcttgaggcggtggcccctgagtcggcggccgccgcacgcaccatcccg
gtggcctcgtcggtcgtcgtggcgctgacgctgcccggcgacgccccgatacccgccaat
tcgggggtgctcgtcgcgtcgggagaagccttgcataccaaggccataacgttctcgacc
agtaagtgggggttgcgcgggcggagtacccaggtggtgcgactttcctatggacgcttc
ggtgacacggtggcgcgcgctaccaccgacgagcagctgcgacactgggccgttgccgat
ctggaggcggtgttgggcgccggcatcgtcccggtcaactcggcggtggcccgctggatc
gatgccatgccgcagtacgggccgggccacgctgaagtcgtcgacgccatccgttccgga
ttgccgtccggaatcgcggtggccggctcgtacctggatgggataggggtgccggcttgt
gtggcctccgcctcgcaagccgcgcaggccagcgtggcacgatggaggcatggctag

DBGET integrated database retrieval system